Sequence:
download
SGD:YBR233Wsequence.fasta
>PBP2 MSTETTKPSITTTPTTVLVSPNTLKRKKGEDTSEEQLEAEIKRVALKDADSHSDNDHDSPDNVPSDVHLRMLCLVKHASL IVGHKGATISRIKSETSARINISNNIRGVPERIVYVRGTCDDVAKAYGMIVRALLEEHGNEDNGEDIEISINLLIPHHLM GCIIGKRGSRLREIEDLSAAKLFASPNQLLLSNDRILTINGVPDAIHIATFYISQTLLNFQMESPQKNVKRSIYYQPTQF NSVLIDHSQPNTIFHQRNHQYHPSDKLLSYKPNKNLPISSTLLSMATPQYTTASVANATAFQPNFVIPNVTVLDGPVISP APGNHLLMNFVQQEIFIDEKFVGNVIGKDGKHINSVKESTGCSIIIQDPVEGSSERRLTIRGTFMASQAAIMLISNKIEI DRSNAERKRRSPL
view sequence (414 aa)
>PBP2
MSTETTKPSITTTPTTVLVSPNTLKRKKGEDTSEEQLEAEIKRVALKDADSHSDNDHDSPDNVPSDVHLRMLCLVKHASL
IVGHKGATISRIKSETSARINISNNIRGVPERIVYVRGTCDDVAKAYGMIVRALLEEHGNEDNGEDIEISINLLIPHHLM
GCIIGKRGSRLREIEDLSAAKLFASPNQLLLSNDRILTINGVPDAIHIATFYISQTLLNFQMESPQKNVKRSIYYQPTQF
NSVLIDHSQPNTIFHQRNHQYHPSDKLLSYKPNKNLPISSTLLSMATPQYTTASVANATAFQPNFVIPNVTVLDGPVISP
APGNHLLMNFVQQEIFIDEKFVGNVIGKDGKHINSVKESTGCSIIIQDPVEGSSERRLTIRGTFMASQAAIMLISNKIEI
DRSNAERKRRSPL
Estimated Isoelectric Point:
7.26932525634766
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys23
Gln16
Leu34
Gly20
Met9
Ser39
Tyr8
His15
Glu23
Arg22
Cys4
Phe11
Pro23
Val25
Asn28
Ala24
Ile40
Asp22