Sequence:
download
SGD:YAR061Wsequence.fasta
>YAR061W MPYHYLFLALFTYLATSNVVSGSTQACLPVGPRKNGMNVNFYKYSLLDSTTYSYPQYMTSGYASNWNETGDAEVIVNVQN SQERPIGVLIYLVSYYPKKRYSRNDRLLFTTTNKFLHVQVCHRRDCLHVCRLLLSAEGCLLQCRFLGHASNFTN
view sequence (335 aa)
>YAR061W
MPYHYLFLALFTYLATSNVVSGSTQACLPVGPRKNGMNVNFYKYSLLDSTTYSYPQYMTSGYASNWNETGDAEVIVNVQN
SQERPIGVLIYLVSYYPKKRYSRNDRLLFTTTNKFLHVQVCHRRDCLHVCRLLLSAEGCLLQCRFLGHASNFTN
Estimated Isoelectric Point:
9.05200958251953
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys5
Gln6
Leu19
Gly8
Met3
Ser13
Tyr13
His5
Glu4
Arg9
Cys6
Phe7
Pro6
Val12
Asn12
Ala7
Ile3
Trp1
Asp4