Sequence:
download
SGD:Q0160sequence.fasta
>SCEI MKNIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDEGKTYCMQFEWKNKAYMDHVCLLYDQWVL SPPHKKERVNHLGNLVITWGAQTFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYNKNSTNKSI VLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDSMSYLIFYNLIKPYLIPQMMYKLPNTISSETFLK
view sequence (236 aa)
>SCEI
MKNIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDEGKTYCMQFEWKNKAYMDHVCLLYDQWVL
SPPHKKERVNHLGNLVITWGAQTFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYNKNSTNKSI
VLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDSMSYLIFYNLIKPYLIPQMMYKLPNTISSETFLK
Estimated Isoelectric Point:
9.31220245361328
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys26
Gln10
Leu26
Gly10
Met9
Ser12
Tyr15
His4
Glu12
Arg4
Cys3
Phe11
Pro9
Val11
Asn25
Ala7
Ile18
Trp5
Asp8