Sequence:
download
RP46962sequence.fasta
>Cre-CEH-22 MFNVSALAGATPSIASVSSIATRSPSEQQHGSSIGVVVNDGTSRTGDGGGAASSASSASAAPPQQQSQSALHNKLDTKWD SLNTGTLDTNLQCAAAWTDIPLLAGYSTAPTFPFDQCAYGSYDPSAAYFASNGIAGPMYTLPPADPFQRQENDLINGANG IKGDKNDIKAEDDEEIIDEMDEENDEEDDGTGKRKKRKRRVLFTKAQTYELERRFRTQKYLSAPEREALAMQIRLTPTQV KIWFQNHRYKTKKSHQDKPINTSILSAMPNAFSSQSATTTFPTRAMPIPMLVRGGDSSARSSDIASSSPYTVAFGSTNSG YLPTPSAYLPTTSGYFSNGPANASSYMTNTQWWPS
view sequence (355 aa)
>Cre-CEH-22
MFNVSALAGATPSIASVSSIATRSPSEQQHGSSIGVVVNDGTSRTGDGGGAASSASSASAAPPQQQSQSALHNKLDTKWD
SLNTGTLDTNLQCAAAWTDIPLLAGYSTAPTFPFDQCAYGSYDPSAAYFASNGIAGPMYTLPPADPFQRQENDLINGANG
IKGDKNDIKAEDDEEIIDEMDEENDEEDDGTGKRKKRKRRVLFTKAQTYELERRFRTQKYLSAPEREALAMQIRLTPTQV
KIWFQNHRYKTKKSHQDKPINTSILSAMPNAFSSQSATTTFPTRAMPIPMLVRGGDSSARSSDIASSSPYTVAFGSTNSG
YLPTPSAYLPTTSGYFSNGPANASSYMTNTQWWPS
Estimated Isoelectric Point:
5.66138458251953
Estimated Molecular Weight:
38.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys16
Gln18
Leu19
Gly24
Met8
Ser44
Tyr13
His4
Glu14
Arg16
Cys2
Phe12
Pro25
Val9
Asn18
Ala39
Ile16
Trp5
Asp22