Sequence:
download
RP46665sequence.fasta
>Cre-TRXR-2 MMSHAQPTARRLLSSAIHYDLIVIGGGSGGLSCSKRAAELGAKVALIDAVEPTPNGYAWGIGGTCANVGCIPKKLMHQAA LVGKELKQAEKYGWNGLDQSKITHDWNSLSQVVNDRVKGNNWVYRVQLRDKGIKYYNAFAEFVEGGQILITTADKKKTET LLTSPNILIATGLRPRYPDIPGALLGITSDDLFTLKNVPGKTLVVGAGYVALECAGFLAGLNQDVEVLVRSRPLKEFDQD CVHFVMEQLKSSGVKVREAVEVEKVEESGDKKKVYFTKNGGVEEYDTVIWAAGRAPRMERMKLENIGVKRNEKSGKILAD EFDKTSVHGIYAVGDIVEGRPELTPLAIQSGKLLADRLFSDSKQTVRFHGIATTVFTPLELSTVGLTEEEAKKKYGEDGI EVFHSHYTPFEYIVPQNKDGEFCYVKAICLRDETQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTVAIHPCSSEE FVKLQVTKRSGKDPRVQGCCG
view sequence (501 aa)
>Cre-TRXR-2
MMSHAQPTARRLLSSAIHYDLIVIGGGSGGLSCSKRAAELGAKVALIDAVEPTPNGYAWGIGGTCANVGCIPKKLMHQAA
LVGKELKQAEKYGWNGLDQSKITHDWNSLSQVVNDRVKGNNWVYRVQLRDKGIKYYNAFAEFVEGGQILITTADKKKTET
LLTSPNILIATGLRPRYPDIPGALLGITSDDLFTLKNVPGKTLVVGAGYVALECAGFLAGLNQDVEVLVRSRPLKEFDQD
CVHFVMEQLKSSGVKVREAVEVEKVEESGDKKKVYFTKNGGVEEYDTVIWAAGRAPRMERMKLENIGVKRNEKSGKILAD
EFDKTSVHGIYAVGDIVEGRPELTPLAIQSGKLLADRLFSDSKQTVRFHGIATTVFTPLELSTVGLTEEEAKKKYGEDGI
EVFHSHYTPFEYIVPQNKDGEFCYVKAICLRDETQKVVGLHFVGPNAAEVMQGYAVAFRVGISISDLQLTVAIHPCSSEE
FVKLQVTKRSGKDPRVQGCCG
Estimated Isoelectric Point:
7.55141448974609
Estimated Molecular Weight:
54.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys40
Gln18
Leu43
Gly49
Met7
Ser27
Tyr16
His11
Glu36
Arg22
Cys10
Phe17
Pro19
Val48
Asn16
Ala38
Ile27
Trp5
Asp25