Sequence:
download
RP45551sequence.fasta
>Cre-MOG-4 MSVEQFINDQLHAIVGISDKSICQYVHALAKKAKTSRDLVEKLGEDCDIKVSPAIQSFADQLLSRMPRQAAPVRQRGPTA TELAEQELKRLNRAVGVLQDDDYVSSKTKNVRKRKESSSEDEAPKPSKKSSKPVKKVEESDDSDIEAIEARLDADIAERD ALAARINKKEKEKTRSVMEKKRDDNKDKEGSSIDKLREESRRQYLKKRKDDKLEELEAIVYDDQTLFANEKLTKREREDM EYRKKVLEYAKAHGKAGEVMKIKRYHLPDATSRSMPTEYIDDDEEDLLPGGDGAKWEADQLTSAMLHIGAKDAKKNEPEF ELLLDEQIDFIQALQMPGTNEKDEEKETEAEKKKMSIAEVRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQY LYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVNCKLGTQVGYQVIEDGKLILFLQVGYSIRFEDCTSEKTVLKYMTDG MLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPV DIYYTQAPEADYLDAAIVTVMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELISLPVYANLPSDLQAK IFEPTPRDARKVVLATNIAETSVTIDGISFVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLY TAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEF PCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESQFSQRWC IENYVQHRTMKRARDVRDQLVGLLERVEIELKSSTDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFE ETPRWVVYYELVFTSKEFMREMSEIESGWLLEVAPHYYKGRELEDSTNKKMPKQRGKSAKELER
view sequence (1024 aa)
>Cre-MOG-4
MSVEQFINDQLHAIVGISDKSICQYVHALAKKAKTSRDLVEKLGEDCDIKVSPAIQSFADQLLSRMPRQAAPVRQRGPTA
TELAEQELKRLNRAVGVLQDDDYVSSKTKNVRKRKESSSEDEAPKPSKKSSKPVKKVEESDDSDIEAIEARLDADIAERD
ALAARINKKEKEKTRSVMEKKRDDNKDKEGSSIDKLREESRRQYLKKRKDDKLEELEAIVYDDQTLFANEKLTKREREDM
EYRKKVLEYAKAHGKAGEVMKIKRYHLPDATSRSMPTEYIDDDEEDLLPGGDGAKWEADQLTSAMLHIGAKDAKKNEPEF
ELLLDEQIDFIQALQMPGTNEKDEEKETEAEKKKMSIAEVRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQY
LYEAGFCEGGKRIGCTQPRRVAAMSVAARVADEVNCKLGTQVGYQVIEDGKLILFLQVGYSIRFEDCTSEKTVLKYMTDG
MLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVKDIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPV
DIYYTQAPEADYLDAAIVTVMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALGSKIKELISLPVYANLPSDLQAK
IFEPTPRDARKVVLATNIAETSVTIDGISFVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLY
TAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQETLVIALEQLYALGALNHRGELTKLGRRMAEF
PCDPCMSKMIIASEKYECSEEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLMNVYNKWQESQFSQRWC
IENYVQHRTMKRARDVRDQLVGLLERVEIELKSSTDTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKHTTHPHPNSCLFE
ETPRWVVYYELVFTSKEFMREMSEIESGWLLEVAPHYYKGRELEDSTNKKMPKQRGKSAKELER
Estimated Isoelectric Point:
6.04964447021484
Estimated Molecular Weight:
116.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr51
Lys90
Gln41
Leu89
Gly49
Met26
Ser64
Tyr33
His24
Glu98
Arg63
Cys13
Phe34
Pro42
Val61
Asn25
Ala85
Ile60
Trp7
Asp69