Sequence:
download
RP44614sequence.fasta
>Cre-ITR-1 MNSTFGRVRKKVSIISVPEFAPDSYENENVATSGGIVGIGSTSRGSTRIEFDFDDFEEQIMRKSSMALPSRKLTIASSID HGNNGNLHIGDIISLYTESSTNQEQRGFLSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKR FQTGDSMFDDDLMNKLRVAADKEREENEAEFQKTLGNVVQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGN EGSWFIIEPAYKHYAIGDNVSAGNKISLIPNAVSTTQTGHVKSQLHLSGFNLLDHQTAAEVNCLNEPTEWQVFMFLLFDE NQQNSVKSGDVVRLFHADQQTFLTLDTIPKINPAKDVVFLRMTNRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKTYR FKHLASDMYLTVEASQIQVKPAVNGRRASLIYSKTNNPMASMYSDGPNGITNGTDKMKLHRQINIPDSSDASNGPNVYFL SPTKSDFPESNENLLFQLDPSTFMKSNKDVPRRSYVRLLHQSTDTWVHATNATEKQNLHFSNKNEKGWVKVICETNRVDK ETFALLPVNPDEVRDLDFANDACKALRNFINLIKIGSVISKEALNSTTQLLIDCILFVTNSSDHLADPLKITDFSPSRDR QKLLREQEVLHQVFLLLKAPFQPRQGSTELGPLLSSPAELSDSRNEIFKTMFQLCYCLLKYSQVSYRKNQEFLAEKFGEI QEQIGFDLMAEDTMTAVLHNNPKLLEKYVKAPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSNTH RDIFMDTKVIEGEIEVGWAPNFRKLVDIAEGAKSNHDDVEHLDYYRFVGDLMIVNDTFFTFSHQLDLLSQMCQEQQYLAI DPPLERGLMNISQQLPAELVLQCMSDTRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEA YSDGSRMRIGASIAHKVLATVETYLMALRNQSTDERHSVNSSKLTYEVSVTRGETYPKYFCFQIVNLAKALAQFNFYSFN ELLQLTQNLLAIINEGPSVEQVPSHRAMVNAIRNMSKSMMRGGSNKESSKDLAKTSSMSTDDAGRSKEGRALIVKTKLIV AEILQFVMDVRRDYRITMALSWFKNVFPCDEDGSLMHSASINERMASELYDAIYHSSGHELHLDGKDGQLLLAILLQMTM SDYPPLTSIALKVLFRHFTQYQELLEDLKQVQLLVSNDDVENYRQIDRDLFILKNLTEKSELWVHGDRNHSVETKEVDDK ERTTEYDLQRHELNTPRAFGSRDSMDAVIAVINEHYSNFKTESLQLLNRLLIKDDRNDAAVALQELSDKAPLIAYPLIRQ MLVRLTRMCYRDGKPDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHEMMKLITLSHEFLRSFCKTNKENQSRLYKFISYE KDAKEGMLRVETVEEVGTLVAIFRNNRELASNVPEELIAHIVGLIEHNSRNPIFLELLQALVCVYDKEIESGQEKVANEI CAASDEVRQLYVDNASFEELEALMKQEKESRGRETDSRKPLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVT SKHCLVEVKTVYLQLLLHCYIDTDAEMKDAYKTEYVDNILNNLLEDIRSLRIEKLTDAETVTLEHYICHTVTEVLIKFFE APYSALQQAKVDVHHHKKTFSEVLLELTSLERGKLKSTRSSRNWYRVAECIKRLTKWAEEHSITLPATLAGPQMAGTASV RQKWQNAATSAKLIGLNKRLNRQNTLNPGHRLYGTSNSMTEHTSANVVTCYHVSYSRGECIQMMIGEFKFYLHPLHAAEG SVLVEVLHTPELLFPEGSSLRDQCARGGVVAKLIQHCKTLMQNKQDNLCARVLQTLCKMCDCTKQQLTQQGQQLRQLLLQ RYFGQHNHHHPPLDRQQSKIGEVIEAVKEKKEETWSQERDLYAIQCKLNDAGASDLVTDIIIMEPSREIFLKAIHLARAL LHEGNDKVQHSFYMRMKQKDIHEPFFKVILTRIQTAQNRLKSDMMSCSDSKPKASLSATVSRRSSTVLTPLIDAGDSGFN GTLFEVPQQVRHPSISEMSQLSNDLTHSIPDLTPYQDEDKSTDALPPEVALVEPILRVLQLLCENHNSLLQNFLRKQSDR TNHNLVSETLSFLDTVCGSTKGSLGVFGEIGEHNFSLITQTLATLTEFCQGPCHENQNTMAMQENGLNIIISLVLNEIKP LADDHMELALEIKSQASKLLLAIMESRHDGENANRVLRNMANMSGGPKQLVHAIKQAYEMTNSNHHMLKSVSRDLFRRAE DDSKNKPGPQITVNTISLPEINVDASGIVSIHTEKNNSSSLDDKFHEEDCPSVDPREVGHNIYILAHQLAIHDGELEIWL DGSDEKKDDLTREALNYYKERTAQIEIVRRDRTLERVVFPINDICSYLTKETKDYVYNNTERDNQGSKVTEFFDQWETMY HEMIWQRKLQDRKWLSWCAFRLPLWTRLSFHFAFIVNALVACYYPFPEHSTTPISFGNSYSWLAVITSFLLAHYLRHDKS YLPKTFLLILASLCFLFVSSIGVNITLYFFGILQLVNKVVHVLAFVSNKGLEDRPLSEILACRNLHYLLVYLAVCIAGFV IHPMIYCALLFDIIATEETLQNVIASVTRNYQSIVWTGLLALILLYGFSILGFLFFRHDFYLDVDPVEADSSATISSGLP SETCPSEGCPGLKPTGKDGDDDDDKKIKSCETLWMCILQTMYLGLRNGGGIGDVLRNPAPWEDMFVWRVAYDMTFFVVLI VIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTG PESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEMKQMKDQMMQMIAMMRENQSQWDEVRAFMEQLQSR
view sequence (2951 aa)
>Cre-ITR-1
MNSTFGRVRKKVSIISVPEFAPDSYENENVATSGGIVGIGSTSRGSTRIEFDFDDFEEQIMRKSSMALPSRKLTIASSID
HGNNGNLHIGDIISLYTESSTNQEQRGFLSTLGLVDDRCIVELKDGRPESPPKKFRDCLFKVCPVNRYAAQKHLWTEQKR
FQTGDSMFDDDLMNKLRVAADKEREENEAEFQKTLGNVVQYGSMVQLLHVKSNKYITVQKNSPAKRERNAMKVYLDRAGN
EGSWFIIEPAYKHYAIGDNVSAGNKISLIPNAVSTTQTGHVKSQLHLSGFNLLDHQTAAEVNCLNEPTEWQVFMFLLFDE
NQQNSVKSGDVVRLFHADQQTFLTLDTIPKINPAKDVVFLRMTNRPSAADATSSRALWEVQVVQTNAYRGGTAKWNKTYR
FKHLASDMYLTVEASQIQVKPAVNGRRASLIYSKTNNPMASMYSDGPNGITNGTDKMKLHRQINIPDSSDASNGPNVYFL
SPTKSDFPESNENLLFQLDPSTFMKSNKDVPRRSYVRLLHQSTDTWVHATNATEKQNLHFSNKNEKGWVKVICETNRVDK
ETFALLPVNPDEVRDLDFANDACKALRNFINLIKIGSVISKEALNSTTQLLIDCILFVTNSSDHLADPLKITDFSPSRDR
QKLLREQEVLHQVFLLLKAPFQPRQGSTELGPLLSSPAELSDSRNEIFKTMFQLCYCLLKYSQVSYRKNQEFLAEKFGEI
QEQIGFDLMAEDTMTAVLHNNPKLLEKYVKAPHVERFVELVRNNRQGKFLDYLADLCVCRGEANKKIQELICTSVLSNTH
RDIFMDTKVIEGEIEVGWAPNFRKLVDIAEGAKSNHDDVEHLDYYRFVGDLMIVNDTFFTFSHQLDLLSQMCQEQQYLAI
DPPLERGLMNISQQLPAELVLQCMSDTRLPYDLRGSFTRLMLHLHVVRGSPMSAIRHARLWWSIPENVNVSTYESVSVEA
YSDGSRMRIGASIAHKVLATVETYLMALRNQSTDERHSVNSSKLTYEVSVTRGETYPKYFCFQIVNLAKALAQFNFYSFN
ELLQLTQNLLAIINEGPSVEQVPSHRAMVNAIRNMSKSMMRGGSNKESSKDLAKTSSMSTDDAGRSKEGRALIVKTKLIV
AEILQFVMDVRRDYRITMALSWFKNVFPCDEDGSLMHSASINERMASELYDAIYHSSGHELHLDGKDGQLLLAILLQMTM
SDYPPLTSIALKVLFRHFTQYQELLEDLKQVQLLVSNDDVENYRQIDRDLFILKNLTEKSELWVHGDRNHSVETKEVDDK
ERTTEYDLQRHELNTPRAFGSRDSMDAVIAVINEHYSNFKTESLQLLNRLLIKDDRNDAAVALQELSDKAPLIAYPLIRQ
MLVRLTRMCYRDGKPDTMNQQLLKNMRVYEVVLEFISVPHDKKHDHEMMKLITLSHEFLRSFCKTNKENQSRLYKFISYE
KDAKEGMLRVETVEEVGTLVAIFRNNRELASNVPEELIAHIVGLIEHNSRNPIFLELLQALVCVYDKEIESGQEKVANEI
CAASDEVRQLYVDNASFEELEALMKQEKESRGRETDSRKPLKYHIELVRLLAMCTRGKNGNTELKCASQIPMDHIVRVVT
SKHCLVEVKTVYLQLLLHCYIDTDAEMKDAYKTEYVDNILNNLLEDIRSLRIEKLTDAETVTLEHYICHTVTEVLIKFFE
APYSALQQAKVDVHHHKKTFSEVLLELTSLERGKLKSTRSSRNWYRVAECIKRLTKWAEEHSITLPATLAGPQMAGTASV
RQKWQNAATSAKLIGLNKRLNRQNTLNPGHRLYGTSNSMTEHTSANVVTCYHVSYSRGECIQMMIGEFKFYLHPLHAAEG
SVLVEVLHTPELLFPEGSSLRDQCARGGVVAKLIQHCKTLMQNKQDNLCARVLQTLCKMCDCTKQQLTQQGQQLRQLLLQ
RYFGQHNHHHPPLDRQQSKIGEVIEAVKEKKEETWSQERDLYAIQCKLNDAGASDLVTDIIIMEPSREIFLKAIHLARAL
LHEGNDKVQHSFYMRMKQKDIHEPFFKVILTRIQTAQNRLKSDMMSCSDSKPKASLSATVSRRSSTVLTPLIDAGDSGFN
GTLFEVPQQVRHPSISEMSQLSNDLTHSIPDLTPYQDEDKSTDALPPEVALVEPILRVLQLLCENHNSLLQNFLRKQSDR
TNHNLVSETLSFLDTVCGSTKGSLGVFGEIGEHNFSLITQTLATLTEFCQGPCHENQNTMAMQENGLNIIISLVLNEIKP
LADDHMELALEIKSQASKLLLAIMESRHDGENANRVLRNMANMSGGPKQLVHAIKQAYEMTNSNHHMLKSVSRDLFRRAE
DDSKNKPGPQITVNTISLPEINVDASGIVSIHTEKNNSSSLDDKFHEEDCPSVDPREVGHNIYILAHQLAIHDGELEIWL
DGSDEKKDDLTREALNYYKERTAQIEIVRRDRTLERVVFPINDICSYLTKETKDYVYNNTERDNQGSKVTEFFDQWETMY
HEMIWQRKLQDRKWLSWCAFRLPLWTRLSFHFAFIVNALVACYYPFPEHSTTPISFGNSYSWLAVITSFLLAHYLRHDKS
YLPKTFLLILASLCFLFVSSIGVNITLYFFGILQLVNKVVHVLAFVSNKGLEDRPLSEILACRNLHYLLVYLAVCIAGFV
IHPMIYCALLFDIIATEETLQNVIASVTRNYQSIVWTGLLALILLYGFSILGFLFFRHDFYLDVDPVEADSSATISSGLP
SETCPSEGCPGLKPTGKDGDDDDDKKIKSCETLWMCILQTMYLGLRNGGGIGDVLRNPAPWEDMFVWRVAYDMTFFVVLI
VIVLNLIFGVIIDTFGDLRAEKNEKEQILKNNCFICGLDRSRFDNRSVTFETHRETEHNIWHYLYYIVMLQIKDETEFTG
PESYVAQCVKDRNLDWFPRMQALSLQDSELDTDQSEMKQMKDQMMQMIAMMRENQSQWDEVRAFMEQLQSR
Estimated Isoelectric Point:
6.03223419189453
Estimated Molecular Weight:
337.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr164
Lys170
Gln141
Leu324
Gly124
Met86
Ser225
Tyr88
His96
Glu206
Arg160
Cys55
Phe120
Pro100
Val191
Asn162
Ala170
Ile163
Trp30
Asp176