Sequence:
download
RP41519sequence.fasta
>Cre-SUP-12 MYGQVQDPLVHAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFV TMKDKASADRACKDPNPIIDGRKANVNLAYLGAKPRNNVQLAALAAGQVQLPLTTQLQALFPQRIGIPQMYYPAVTGFNP LISAQGAAAQQQLIDYSALAAVMGQNPQAAYGLQAQGKFASAGPTTIEQYAAYPAGYGLVPQAAYNIGNSQLQLAAAQQQ LEHQRV
view sequence (246 aa)
>Cre-SUP-12
MYGQVQDPLVHAAAALAQSTNAEPVVGSRDTMFTKIFVGGLPYHTSDKTLHEYFEQFGDIEEAVVITDRNTQKSRGYGFV
TMKDKASADRACKDPNPIIDGRKANVNLAYLGAKPRNNVQLAALAAGQVQLPLTTQLQALFPQRIGIPQMYYPAVTGFNP
LISAQGAAAQQQLIDYSALAAVMGQNPQAAYGLQAQGKFASAGPTTIEQYAAYPAGYGLVPQAAYNIGNSQLQLAAAQQQ
LEHQRV
Estimated Isoelectric Point:
6.90029144287109
Estimated Molecular Weight:
26.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys9
Gln28
Leu20
Gly20
Met5
Ser9
Tyr13
His4
Glu7
Arg8
Cys1
Phe8
Pro15
Val15
Asn11
Ala39
Ile11
Asp10