Sequence:
download
RP41134sequence.fasta
>Cre-ZYG-12 MLDLTNPDSDASENGNSKYADSSDGQGVGTSRKPEVDKFTLEERRKDLADLAIWLSGLNGTKLALDDPHSLCNGRAFAEL LHVIDDSFFDERWLETMPGMRTTSNLVVKRSNIRKLWRKISDYYSMLGRNIGQRWYEIGERVDNIEETDIPVAVDLAMAV VAIALIGTRKEKWISYSQEFAKTYRNEMTNVARMVEIVVKEMPELSDNVTFHEISDLHDSQNELNCSQPESSVVSNKNGF GERRRSSSNNDQVLVEAQQEIDSLRSEKDSLLKEVERLTKASDNAQFDDSISSAVTILEKQNEELRIKRRQMEEKTLELE AALEHFQSTVKKLTEENDTLQSSQKEFNMLRSHLDSAQSDVEEWRAKANQYQTDAELGKKREKEVKELQGQVSSLTSRLA HLIKTATEDEDNKAGIMQLRSQLGTITANNVELNVALESKQRIVEQLEIQLIQYKEKVKELEDRKEDLIAERNELENQLH FKDQVTPRSLHESMFEAGNLSFEPFSEKSKLPLEIENKRLAERIHELEALEPLKGEIITMRSQNGLLEEQKLVIKKQMEE LERQVAELQEKLALNQKNASGDSVELRIQLEKANVEVERMKEAEMRAETKLADVKELLQKRNAEYEANEKALERAKSVID EMEDRCRPVGEDSITSVQAFKEMKEENERLRQKVEKYEIDLNTTTQSYEQENRLITSAAYQQVSFFKNQPRQTFSKVLDR SSDAVMSMRAQGGTDAPRTMLDAQKANSALPWR
view sequence (753 aa)
>Cre-ZYG-12
MLDLTNPDSDASENGNSKYADSSDGQGVGTSRKPEVDKFTLEERRKDLADLAIWLSGLNGTKLALDDPHSLCNGRAFAEL
LHVIDDSFFDERWLETMPGMRTTSNLVVKRSNIRKLWRKISDYYSMLGRNIGQRWYEIGERVDNIEETDIPVAVDLAMAV
VAIALIGTRKEKWISYSQEFAKTYRNEMTNVARMVEIVVKEMPELSDNVTFHEISDLHDSQNELNCSQPESSVVSNKNGF
GERRRSSSNNDQVLVEAQQEIDSLRSEKDSLLKEVERLTKASDNAQFDDSISSAVTILEKQNEELRIKRRQMEEKTLELE
AALEHFQSTVKKLTEENDTLQSSQKEFNMLRSHLDSAQSDVEEWRAKANQYQTDAELGKKREKEVKELQGQVSSLTSRLA
HLIKTATEDEDNKAGIMQLRSQLGTITANNVELNVALESKQRIVEQLEIQLIQYKEKVKELEDRKEDLIAERNELENQLH
FKDQVTPRSLHESMFEAGNLSFEPFSEKSKLPLEIENKRLAERIHELEALEPLKGEIITMRSQNGLLEEQKLVIKKQMEE
LERQVAELQEKLALNQKNASGDSVELRIQLEKANVEVERMKEAEMRAETKLADVKELLQKRNAEYEANEKALERAKSVID
EMEDRCRPVGEDSITSVQAFKEMKEENERLRQKVEKYEIDLNTTTQSYEQENRLITSAAYQQVSFFKNQPRQTFSKVLDR
SSDAVMSMRAQGGTDAPRTMLDAQKANSALPWR
Estimated Isoelectric Point:
5.04006195068359
Estimated Molecular Weight:
86.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys58
Gln45
Leu77
Gly25
Met21
Ser62
Tyr12
His10
Glu97
Arg51
Cys3
Phe18
Pro15
Val43
Asn42
Ala53
Ile34
Trp7
Asp45