Sequence:
download
RP36949sequence.fasta
>Cre-RAD-54 MSSKTFHPGDFVWAKFPGFPPWPARVCSSSIYILLKTIYVQVMHCEQKRGKAHYTVEYFGSKEIGNVKYDEVDDYYEKRE RFAKSKRVKGFNEAVDEIESLIDKTVLKIDTQAEHNHEYQEEDVQKGTTSAPQESPPVAQIQNEIKHEKPILSSDESDCS FDIQQIPVKSSPVETEKTSSQETKEDNIDVRKIPHLDSPVVVERARIAIDDDDDDFLEMLDENDGTILTEGTATVVVKKK TEMKTEKKVKKELVKIDLKPEVKTAEKEVTEMIPEVVEEPDIIEIPDVTPDIPSTSSSKRKRETSPENLPSTSSSSVPAQ KRRSLGYSGKTTEPKNIHKSFVSPFGTSVSPTKQGLRRRKKAPPAIEPPVSVEEANPLRFVNIDVFSRRMASESSDHDAM IAKLLSRKFSIPMEGYMLSGRSLGLGGNRRKCALFDPYHEGALILYAPELISEHAQLKEDKDRKVHVVADPVVGKILRPH QRDGVKFMWDCVTGVNIPEYHGCIMADEMGLGKTLQCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGT RLNAMPVDSGKRELIIASLNSFMADSKMRCAIPVLIISYETFRLYANILHSGDVGIVICDEGHRLKNSDNLTYQALSGLK CARRVLISGTPIQNDLLEYFSLVNFVNPGLLGTASEFRKKFENAILKGRDADASAEDQKKGEEKTKEMVSLVEKCIIRRT SALLTKYLPVKYEHIICCKNSTLQETLYNKLIECEKQNRIVEKDKGATASALSFITHLKKLCNHPYLVYEEFQKPDNRFR NKCLPVFPEAFNPKSFDPSFSGKMKVLDYILAVTRKTTDDKFVLVSNYTQTIDQFMALCKLRGYDFVRLDGSMSIKQRSK IVDTFNDPSSTIFCFLLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKTCFIYRLLATGSIEEKMFQR QTHKKALSSCVVSFKRYNNENSIYHFRNEQLRELFKLESTVASDTHEKLKCKRCIQGLESVDPPVNADCASDLSNWFHSE KTARKVADNVLRAVFECGSISFVFHQKSHNVEAKKVEEKVEELDDDYVPSEAEEDD
view sequence (1096 aa)
>Cre-RAD-54
MSSKTFHPGDFVWAKFPGFPPWPARVCSSSIYILLKTIYVQVMHCEQKRGKAHYTVEYFGSKEIGNVKYDEVDDYYEKRE
RFAKSKRVKGFNEAVDEIESLIDKTVLKIDTQAEHNHEYQEEDVQKGTTSAPQESPPVAQIQNEIKHEKPILSSDESDCS
FDIQQIPVKSSPVETEKTSSQETKEDNIDVRKIPHLDSPVVVERARIAIDDDDDDFLEMLDENDGTILTEGTATVVVKKK
TEMKTEKKVKKELVKIDLKPEVKTAEKEVTEMIPEVVEEPDIIEIPDVTPDIPSTSSSKRKRETSPENLPSTSSSSVPAQ
KRRSLGYSGKTTEPKNIHKSFVSPFGTSVSPTKQGLRRRKKAPPAIEPPVSVEEANPLRFVNIDVFSRRMASESSDHDAM
IAKLLSRKFSIPMEGYMLSGRSLGLGGNRRKCALFDPYHEGALILYAPELISEHAQLKEDKDRKVHVVADPVVGKILRPH
QRDGVKFMWDCVTGVNIPEYHGCIMADEMGLGKTLQCISLLWTLLRQSPDACPTVSKSIIVCPSSLVKNWDKEIKKWLGT
RLNAMPVDSGKRELIIASLNSFMADSKMRCAIPVLIISYETFRLYANILHSGDVGIVICDEGHRLKNSDNLTYQALSGLK
CARRVLISGTPIQNDLLEYFSLVNFVNPGLLGTASEFRKKFENAILKGRDADASAEDQKKGEEKTKEMVSLVEKCIIRRT
SALLTKYLPVKYEHIICCKNSTLQETLYNKLIECEKQNRIVEKDKGATASALSFITHLKKLCNHPYLVYEEFQKPDNRFR
NKCLPVFPEAFNPKSFDPSFSGKMKVLDYILAVTRKTTDDKFVLVSNYTQTIDQFMALCKLRGYDFVRLDGSMSIKQRSK
IVDTFNDPSSTIFCFLLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKTCFIYRLLATGSIEEKMFQR
QTHKKALSSCVVSFKRYNNENSIYHFRNEQLRELFKLESTVASDTHEKLKCKRCIQGLESVDPPVNADCASDLSNWFHSE
KTARKVADNVLRAVFECGSISFVFHQKSHNVEAKKVEEKVEELDDDYVPSEAEEDD
Estimated Isoelectric Point:
6.81911468505859
Estimated Molecular Weight:
124.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr55
Lys103
Gln33
Leu85
Gly48
Met22
Ser94
Tyr29
His25
Glu88
Arg55
Cys27
Phe45
Pro56
Val80
Asn43
Ala60
Ile66
Trp9
Asp73