Sequence:
download
RP35455sequence.fasta
>Cre-LEV-10 MRSLERIVETRIELLEWDSKETKEDCARCRALDCDIIFALLFTIVIACLLVLIMVFWLKGVLQYEDCDIEYVDIYSEVES VDEDILSSALGGRYCGTVAPHVRISLRHVMKIVLHSRSTNHEDSHGFRAKYSFIPEDKFIAGEPVSGKKCSYIIDSSDRK IGTLYSPTYPGTYPHNMHCSYLMKGYRGERIRLFFTDFDIFFGGEHCPYDSITIFDGPTPSSPIIRKVCGLQQRMEIYSM TNSLLIHFNTTHPAKSDPRGFIMDYEFSSRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETTHTISSPNYPEVYPANTT CTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSVDDIACPSAWVGIAIGEGNMKAVMSSTDDSIFDVTLCERIP SDSPLLGPYISEGPRMVMQFGSTDTRDDRITPIGFKATIEFKTDFGVTGESLGTSNECRFRFTSSTGFFNSPRYPANYPL DTNCTYYIVGQPGREILLHFEQFALSGDNDNNCNDYLDVYDVFVKNGKEELKLKERYCSDTFPGPSVSAFGSHEMRVVFT SGSSGTANGFKALFEIRTARKEDVPHGEAHIRRGAYRCGSVINSTSLKPNGLIISPNYPVKYNKDVHCDWQINVKEGYQV LLKMEAIDVEGEMTSDSASCQKAVIRVEGAPRTEYCGTKREFFEAYLSPTNSVRISFLTAPDKVNGLKGFNLSWTEVKNL SGKDESVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHCSLKEKTADRTVVIAAIFCGGIFVFICGFFLYL FKKKLERKKKSKRKSDTKHRQRQPYRQQKPMHKQHCDSELSPPATSRFVHHDATGIMPPIPLHQIGSSSRDMYS
view sequence (874 aa)
>Cre-LEV-10
MRSLERIVETRIELLEWDSKETKEDCARCRALDCDIIFALLFTIVIACLLVLIMVFWLKGVLQYEDCDIEYVDIYSEVES
VDEDILSSALGGRYCGTVAPHVRISLRHVMKIVLHSRSTNHEDSHGFRAKYSFIPEDKFIAGEPVSGKKCSYIIDSSDRK
IGTLYSPTYPGTYPHNMHCSYLMKGYRGERIRLFFTDFDIFFGGEHCPYDSITIFDGPTPSSPIIRKVCGLQQRMEIYSM
TNSLLIHFNTTHPAKSDPRGFIMDYEFSSRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETTHTISSPNYPEVYPANTT
CTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSVDDIACPSAWVGIAIGEGNMKAVMSSTDDSIFDVTLCERIP
SDSPLLGPYISEGPRMVMQFGSTDTRDDRITPIGFKATIEFKTDFGVTGESLGTSNECRFRFTSSTGFFNSPRYPANYPL
DTNCTYYIVGQPGREILLHFEQFALSGDNDNNCNDYLDVYDVFVKNGKEELKLKERYCSDTFPGPSVSAFGSHEMRVVFT
SGSSGTANGFKALFEIRTARKEDVPHGEAHIRRGAYRCGSVINSTSLKPNGLIISPNYPVKYNKDVHCDWQINVKEGYQV
LLKMEAIDVEGEMTSDSASCQKAVIRVEGAPRTEYCGTKREFFEAYLSPTNSVRISFLTAPDKVNGLKGFNLSWTEVKNL
SGKDESVCKSDSLYLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHCSLKEKTADRTVVIAAIFCGGIFVFICGFFLYL
FKKKLERKKKSKRKSDTKHRQRQPYRQQKPMHKQHCDSELSPPATSRFVHHDATGIMPPIPLHQIGSSSRDMYS
Estimated Isoelectric Point:
6.23207855224609
Estimated Molecular Weight:
98.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr56
Lys51
Gln20
Leu59
Gly59
Met18
Ser79
Tyr37
His25
Glu53
Arg50
Cys31
Phe46
Pro44
Val52
Asn32
Ala38
Ile61
Trp5
Asp58