Sequence:
download
RP33863sequence.fasta
>Cre-DOP-3 MLAGQHHVPGIESPLMVVLWRVAAGVFLPLIPTMAVFGNALVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVY YEWNSFKWGLGAFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSIAVALPLLL GVNPMENDQCELANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK HFKNRTDQILLEISFQKEKGDNLKKWYVLQTSSFPTMSESSDDGSTISPMINSFNNFLPKKTTYPSTSIPAIPECGSMPN LTIIEKPEEEKDIELSIMDLRDTVEMLDDKYSSAMITRSFGEELEEILPFIDGSTSVKHSREQLHTTRSNTSTTRLLDVK PELRSISVPSIQDEKKLGQKPSETPFAHQNGTNKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNNNRSSHKKSLADLLA NDEFSFSDSMRVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFILHLSNSICL ILDPNSDCVGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGIFKKR
view sequence (615 aa)
>Cre-DOP-3
MLAGQHHVPGIESPLMVVLWRVAAGVFLPLIPTMAVFGNALVIMSVFRERSLQTVTNMLIVSLAVSDFMVAIGVMSFGVY
YEWNSFKWGLGAFFCHVYQALDVACSTASILNLLAISLDRYIAIGHPISYAQYGARGGRAMISITIVWGVSIAVALPLLL
GVNPMENDQCELANPYFNMISSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK
HFKNRTDQILLEISFQKEKGDNLKKWYVLQTSSFPTMSESSDDGSTISPMINSFNNFLPKKTTYPSTSIPAIPECGSMPN
LTIIEKPEEEKDIELSIMDLRDTVEMLDDKYSSAMITRSFGEELEEILPFIDGSTSVKHSREQLHTTRSNTSTTRLLDVK
PELRSISVPSIQDEKKLGQKPSETPFAHQNGTNKQKLLPNPGILMKSKSTTLLKTNGYMDTDSLNNNRSSHKKSLADLLA
NDEFSFSDSMRVYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFILHLSNSICL
ILDPNSDCVGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGIFKKR
Estimated Isoelectric Point:
9.32993316650391
Estimated Molecular Weight:
69.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys34
Gln20
Leu68
Gly30
Met23
Ser64
Tyr16
His12
Glu27
Arg34
Cys9
Phe33
Pro30
Val33
Asn31
Ala37
Ile46
Trp8
Asp25