Sequence:
download
RP32953sequence.fasta
>Cre-LIN-7 MDTPDGPNLERDVQRILELMEHVQKTGEVNNPKLASLQQVLQSEFFGAVREVYETVYDSIDADTTPTTKAAATAKATVAA FAAAEGHAHPRIIELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLIAVNGVNVESECHEKAVDLLK SAVGSVKLVVRYMPKLLDEMERRFERQRLRSTQQSPTLPTPSGPSTAPRR
view sequence (210 aa)
>Cre-LIN-7
MDTPDGPNLERDVQRILELMEHVQKTGEVNNPKLASLQQVLQSEFFGAVREVYETVYDSIDADTTPTTKAAATAKATVAA
FAAAEGHAHPRIIELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLIAVNGVNVESECHEKAVDLLK
SAVGSVKLVVRYMPKLLDEMERRFERQRLRSTQQSPTLPTPSGPSTAPRR
Estimated Isoelectric Point:
6.44570159912109
Estimated Molecular Weight:
22.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys11
Gln12
Leu17
Gly16
Met5
Ser12
Tyr4
His4
Glu16
Arg15
Cys1
Phe5
Pro14
Val18
Asn7
Ala19
Ile9
Asp11