Sequence:
download
RP26737sequence.fasta
>Cre-HRP-1 MTDVEVKTENGGGDANLEPENLRKIFVGGLTSNTTDELMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFTAKTEVDAA MKQRPHVIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHNEDMLTDYFSKYGNVTKSEIILDKATQKPRGFGFV TFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMSRDRETRGGRSRDGPRGGYNGGGGGWGGPAPRGGPGGWGG PGGGGQGGYGGGISDYGGGWGQQGGGGAGGQGGWGGPQAQGGWGGQQQGGWGGPQQQQGGWGGPQQPQQGGWGGQQAPAQ QQGGWGGQSGAQQWAHAQGGNRNY
view sequence (344 aa)
>Cre-HRP-1
MTDVEVKTENGGGDANLEPENLRKIFVGGLTSNTTDELMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFTAKTEVDAA
MKQRPHVIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHNEDMLTDYFSKYGNVTKSEIILDKATQKPRGFGFV
TFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMSRDRETRGGRSRDGPRGGYNGGGGGWGGPAPRGGPGGWGG
PGGGGQGGYGGGISDYGGGWGQQGGGGAGGQGGWGGPQAQGGWGGQQQGGWGGPQQQQGGWGGPQQPQQGGWGGQQAPAQ
QQGGWGGQSGAQQWAHAQGGNRNY
Estimated Isoelectric Point:
8.41904449462891
Estimated Molecular Weight:
36.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys17
Gln32
Leu9
Gly79
Met8
Ser17
Tyr8
His6
Glu14
Arg22
Cys2
Phe10
Pro16
Val18
Asn12
Ala15
Ile8
Trp10
Asp23