Sequence:
download
RP24370sequence.fasta
>Cre-RHEB-1 MSNSNRQSLNRKVAVMGYPHVGKSAIVLRFTQNVFPERYESTIEDQHTKHMTAFQRDYNLRVTDTAGQQEYTVFPRSCSL DINGFILVYAIDDRKSFEMCTNIYEKIVRTYGDTSIPIVIVGNKSDLNTQRVVQQVEGQKLAEEWDAKFVEITAKESNRV SEVFELLLREIEISRGNLSPTVNRNGNGQKIPPTKDNDKCSIS
view sequence (203 aa)
>Cre-RHEB-1
MSNSNRQSLNRKVAVMGYPHVGKSAIVLRFTQNVFPERYESTIEDQHTKHMTAFQRDYNLRVTDTAGQQEYTVFPRSCSL
DINGFILVYAIDDRKSFEMCTNIYEKIVRTYGDTSIPIVIVGNKSDLNTQRVVQQVEGQKLAEEWDAKFVEITAKESNRV
SEVFELLLREIEISRGNLSPTVNRNGNGQKIPPTKDNDKCSIS
Estimated Isoelectric Point:
6.84015655517578
Estimated Molecular Weight:
23.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys12
Gln11
Leu11
Gly10
Met4
Ser16
Tyr7
His3
Glu15
Arg14
Cys3
Phe8
Pro7
Val18
Asn15
Ala8
Ile15
Trp1
Asp11