Sequence:
download
RP23804sequence.fasta
>Cre-HRP-2 MSEEVKQEVKQEAEEVKVAATAAVAVAEAKTEEVAPAPEETPTDTVVATTEITTDATAETATNGAKPAENGSSGEPSKYA DTENYKKLIGLKMKPAIADVVCEIYESGLLSPEDLDDRAVDIINSVNLEQAKFIFSEIKSSELFGVTTKSLYVTSLIRSF KDRCRQQGANAVTSGKLINGPELESLKKMLEDTGYQLEVTIGQRKVGGPPPDWDGPITGPAGSGHEIYVGHIPTDLFEDT LVPLFAESGKIWDFRLMMDPMTGASRGYAFVTYCEKEHATNAAKKFDGHEISTGKPLKVNVSIANTRLFLGNIPKTKSKD EILEELKSHAEGVTDVIVYSVPDNEKIRNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEQQEEPDEDTMSK VKVLYIRNIKEAVTEEKLTELFKEYASLDRVKKVKDYAFIHFNERDDCMKAMEQWNGKELEGTVVEASLAKPPQEKKKKP AMRGRGFGGGSGGGNQGGRGGNHHRGGGGGNYGNHGNHGNQGNQGGYYPNQYGFNNGYDMPMPWGGGYGGDMGYGGYNGG GYGGPGAYGDFGGGYGGPAGFNGGGFRGGPRGSPRGGGFRGSPGRGGMANRRGRGKRPGDGRGGPASKRDNGKPDFTADV NMSTF
view sequence (645 aa)
>Cre-HRP-2
MSEEVKQEVKQEAEEVKVAATAAVAVAEAKTEEVAPAPEETPTDTVVATTEITTDATAETATNGAKPAENGSSGEPSKYA
DTENYKKLIGLKMKPAIADVVCEIYESGLLSPEDLDDRAVDIINSVNLEQAKFIFSEIKSSELFGVTTKSLYVTSLIRSF
KDRCRQQGANAVTSGKLINGPELESLKKMLEDTGYQLEVTIGQRKVGGPPPDWDGPITGPAGSGHEIYVGHIPTDLFEDT
LVPLFAESGKIWDFRLMMDPMTGASRGYAFVTYCEKEHATNAAKKFDGHEISTGKPLKVNVSIANTRLFLGNIPKTKSKD
EILEELKSHAEGVTDVIVYSVPDNEKIRNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDWAEQQEEPDEDTMSK
VKVLYIRNIKEAVTEEKLTELFKEYASLDRVKKVKDYAFIHFNERDDCMKAMEQWNGKELEGTVVEASLAKPPQEKKKKP
AMRGRGFGGGSGGGNQGGRGGNHHRGGGGGNYGNHGNHGNQGNQGGYYPNQYGFNNGYDMPMPWGGGYGGDMGYGGYNGG
GYGGPGAYGDFGGGYGGPAGFNGGGFRGGPRGSPRGGGFRGSPGRGGMANRRGRGKRPGDGRGGPASKRDNGKPDFTADV
NMSTF
Estimated Isoelectric Point:
5.88237762451172
Estimated Molecular Weight:
69.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys51
Gln16
Leu29
Gly94
Met15
Ser32
Tyr24
His12
Glu52
Arg30
Cys5
Phe25
Pro35
Val38
Asn32
Ala48
Ile28
Trp5
Asp38