Sequence:
download
RP21511sequence.fasta
>Cre-GLD-2 MPATISSMMCDVSHGGETSVSGDPSPSQSSLSSRIMNGFSHSMSHIHHHNYPTTTTRRKYQTSISTQSSSSTTTSLERIS TSTCTSSVSSASEVCLSRAEKDVQTMLTSDASTEEESDEDCDDEEEDDEDDDDEDEDDDEDDDSDSEDYDSEESGSETES EDSHVADEEEEIMEPFVSSWCFAMGTQRSIISSVGEKAPKSNVEHMEDWELDVVERAHRDSRLAELYADLSWRFYTHPPT SFCLARVFMRHGLTGNEGMSVFKLPRKANRRDSIDSSISSASGACSPALDESTLTKIMPTDEFRGGRGVASPSPPAALLS EPLSRMDVLSEKIWDYHNKVSQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQ KNDAVVVLNLILSTLQYEKFVASQKLILAKVPILRIKFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVV KEWAKRKGINDANKSSFTSYSLVLMVIHYLQCGTQTKVLPNLQQSYPTRFSNKVDVRTLNVTMPLEAVQDDIDPSLSENT TLGELLIGFLDYYANEFNYDRDAISIRQGKRVERAALAARPKVHLSSEGDKETPPPSSSASSSSIHNGVAGIPMHHSMSN PHFWRSQWRCVCIEEPFTNSNTAHSIYDEMVFGAIKDAFREAHGELQHNRDLDRLLECEPIKASTTNAGAAVFAATYEGE RPLAQQPTSIASASLRAMNVIPSTNGNGHYHYQQQSNQQLMKQQRSGSNLGYQPSNNRGVNGNNNQHQQQNRRVYNSMSS SNAGNSGNGSGARSSKSNENVKESLSRPPSNPRNSSGSAKENLISTNGVTTLAEKKSQSVTKKDEGNRTKRSSAVQSPEP TKPKAEKTPTKAAQ
view sequence (894 aa)
>Cre-GLD-2
MPATISSMMCDVSHGGETSVSGDPSPSQSSLSSRIMNGFSHSMSHIHHHNYPTTTTRRKYQTSISTQSSSSTTTSLERIS
TSTCTSSVSSASEVCLSRAEKDVQTMLTSDASTEEESDEDCDDEEEDDEDDDDEDEDDDEDDDSDSEDYDSEESGSETES
EDSHVADEEEEIMEPFVSSWCFAMGTQRSIISSVGEKAPKSNVEHMEDWELDVVERAHRDSRLAELYADLSWRFYTHPPT
SFCLARVFMRHGLTGNEGMSVFKLPRKANRRDSIDSSISSASGACSPALDESTLTKIMPTDEFRGGRGVASPSPPAALLS
EPLSRMDVLSEKIWDYHNKVSQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNGFGNNSSDMDLCLMITNKDLDQ
KNDAVVVLNLILSTLQYEKFVASQKLILAKVPILRIKFAAPFDDITVDLNANNSVAIRNTHLLCYYSSYDWRVRPLVSVV
KEWAKRKGINDANKSSFTSYSLVLMVIHYLQCGTQTKVLPNLQQSYPTRFSNKVDVRTLNVTMPLEAVQDDIDPSLSENT
TLGELLIGFLDYYANEFNYDRDAISIRQGKRVERAALAARPKVHLSSEGDKETPPPSSSASSSSIHNGVAGIPMHHSMSN
PHFWRSQWRCVCIEEPFTNSNTAHSIYDEMVFGAIKDAFREAHGELQHNRDLDRLLECEPIKASTTNAGAAVFAATYEGE
RPLAQQPTSIASASLRAMNVIPSTNGNGHYHYQQQSNQQLMKQQRSGSNLGYQPSNNRGVNGNNNQHQQQNRRVYNSMSS
SNAGNSGNGSGARSSKSNENVKESLSRPPSNPRNSSGSAKENLISTNGVTTLAEKKSQSVTKKDEGNRTKRSSAVQSPEP
TKPKAEKTPTKAAQ
Estimated Isoelectric Point:
5.19557952880859
Estimated Molecular Weight:
98.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr55
Lys40
Gln35
Leu63
Gly43
Met25
Ser128
Tyr24
His26
Glu63
Arg48
Cys13
Phe22
Pro43
Val50
Asn53
Ala59
Ile35
Trp8
Asp61