Sequence:
download
RP15394sequence.fasta
>Cre-MAB-3 MLTEDSVPEICKATGVDVLAEQEKNYYCQRCLNHGEYKPRKGHKPDCRYLQCPCAECTMVERRRQLNNMLSKKKVHCAPN TQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCTCTLCALVENRRMLMAAQIKLRRSQQKTRDGKEPKIRRCRK IKDMNIENLNTLMMVVTTTTEDQKRTGTSTSPSPSSTTDTMSPSQSVSPPSSPSPSVHSIHQNTPILAAPIPVYPPISMP NLQQLLQQQILLTYLQNIAPSPPPQQAMPFSTLAPSNFVMSEQSLALCNMYLQGCLKI
view sequence (298 aa)
>Cre-MAB-3
MLTEDSVPEICKATGVDVLAEQEKNYYCQRCLNHGEYKPRKGHKPDCRYLQCPCAECTMVERRRQLNNMLSKKKVHCAPN
TQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCTCTLCALVENRRMLMAAQIKLRRSQQKTRDGKEPKIRRCRK
IKDMNIENLNTLMMVVTTTTEDQKRTGTSTSPSPSSTTDTMSPSQSVSPPSSPSPSVHSIHQNTPILAAPIPVYPPISMP
NLQQLLQQQILLTYLQNIAPSPPPQQAMPFSTLAPSNFVMSEQSLALCNMYLQGCLKI
Estimated Isoelectric Point:
9.38707733154297
Estimated Molecular Weight:
33.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys18
Gln22
Leu26
Gly9
Met14
Ser24
Tyr7
His8
Glu12
Arg21
Cys17
Phe3
Pro27
Val16
Asn14
Ala15
Ile12
Asp9