Sequence:
download
RP12117sequence.fasta
>Cre-DCS-1 MKRVAENQLTEQERTEETSQEWLKNAKFQEVLGADSSHKSLFLLLSQPDGSQGILLANKSPFSEDKTDIEKLLETAKLHE ISRNDIFGSYNIEVDGQLNLLKSQLIYPVNERLIAKYRQEEKFVIRETPELYETVTKPYIEKFQLNLNWVYNCLEKRSEV DKIVFEDPDKNNGFLLMQDIKWDGKTIENLYVLAIIHRHGLKSVRDLTGDDLPMLHNIRDKSLKAIEEKYGLKNDQVKCY FHYQPSFYHLHVHFINLKYDAPASTTLSAILLDDVINNLELNSNHYKQSTLTFTRKNGDKLMEMFREANGK
view sequence (311 aa)
>Cre-DCS-1
MKRVAENQLTEQERTEETSQEWLKNAKFQEVLGADSSHKSLFLLLSQPDGSQGILLANKSPFSEDKTDIEKLLETAKLHE
ISRNDIFGSYNIEVDGQLNLLKSQLIYPVNERLIAKYRQEEKFVIRETPELYETVTKPYIEKFQLNLNWVYNCLEKRSEV
DKIVFEDPDKNNGFLLMQDIKWDGKTIENLYVLAIIHRHGLKSVRDLTGDDLPMLHNIRDKSLKAIEEKYGLKNDQVKCY
FHYQPSFYHLHVHFINLKYDAPASTTLSAILLDDVINNLELNSNHYKQSTLTFTRKNGDKLMEMFREANGK
Estimated Isoelectric Point:
5.85695648193359
Estimated Molecular Weight:
36.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys29
Gln14
Leu40
Gly12
Met5
Ser19
Tyr13
His10
Glu28
Arg12
Cys2
Phe13
Pro9
Val14
Asn22
Ala12
Ile19
Trp3
Asp20