Sequence:
download
RP11857sequence.fasta
>Cre-RNP-3 MADINPNHTVYVNNLNEKIKRDELKRSLHMIFTQFGEIIQLMSFRKEKMRGQAHVVFKEISSASNALRALQGFPFYGKPM RIQYAREDSDVIARAKGTFVEKRATKSVTRSAAKKPYDKPTGKEHKKGGDAEKVNTETTETEGPGQPNNILFCSNIPDET DPEQIQTIFGQFPGLREVRWMPNTKDFAFIEYESEDHSESARQALDNFRITPNHQIKVKFASK
view sequence (223 aa)
>Cre-RNP-3
MADINPNHTVYVNNLNEKIKRDELKRSLHMIFTQFGEIIQLMSFRKEKMRGQAHVVFKEISSASNALRALQGFPFYGKPM
RIQYAREDSDVIARAKGTFVEKRATKSVTRSAAKKPYDKPTGKEHKKGGDAEKVNTETTETEGPGQPNNILFCSNIPDET
DPEQIQTIFGQFPGLREVRWMPNTKDFAFIEYESEDHSESARQALDNFRITPNHQIKVKFASK
Estimated Isoelectric Point:
9.17591094970703
Estimated Molecular Weight:
25.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys21
Gln11
Leu9
Gly12
Met6
Ser13
Tyr5
His6
Glu19
Arg14
Cys1
Phe14
Pro12
Val10
Asn13
Ala16
Ile15
Trp1
Asp11