Sequence:
download
RP09316sequence.fasta
>Cre-GPA-16 MGCIMSQEDEAAKRRSKKIDRLLREDAESSNRTVKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILS LNAIIRAMEQLQISFATMDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDEGIQKALERSREYQLNDSAGYYLSQLD RICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQT NRMRESLKLFDSICNNKWFTETSIILFLNKKDLFEEKIQKSPLTHCFPEYTGANNYEEASAYIQQQFEEVNKRTAGQKNQ EIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
view sequence (357 aa)
>Cre-GPA-16
MGCIMSQEDEAAKRRSKKIDRLLREDAESSNRTVKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILS
LNAIIRAMEQLQISFATMDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDEGIQKALERSREYQLNDSAGYYLSQLD
RICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQT
NRMRESLKLFDSICNNKWFTETSIILFLNKKDLFEEKIQKSPLTHCFPEYTGANNYEEASAYIQQQFEEVNKRTAGQKNQ
EIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY
Estimated Isoelectric Point:
5.25891876220703
Estimated Molecular Weight:
41.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr25
Lys22
Gln18
Leu33
Gly16
Met9
Ser22
Tyr13
His4
Glu32
Arg24
Cys9
Phe17
Pro5
Val19
Asn16
Ala19
Ile28
Trp3
Asp23