Sequence:
download
PP75563sequence.fasta
>Ppa-CEH-22 MEYYSRLAAALEQVLLFSGSGSGPKTRLQKLLLGRTGSNGGGMAPPPSSTGAPSPPPPTSFPSSSQPPALTLHHHPHSMF TTMDLPKSEIPKWDITPAEAALAQPQLTHWDPQLGVLGYPTLDPSYAYDHSAYLHPSYGLNVPSSSNLINTVPYPQVKNE PGVAVHSAPSSVFLTNRDASPSQSNASDKIAHDSEMGDEIEDEEEEEDCGDGKKKKRKRRVLFSKGQTYELEKRFRMQRY LSAPEREQLAQEIRLTPTQVKIWFQNHRYKENTGLGSSILTRTNRYKTKKTDVPVKTSSSPFVPTLQPTPVCALPSSSAF SPTGNTTKRFPVQMVVRDGKVADSGNYLPQNFGNAGYLPPSSSYGLPMGSYIPTANGQQYAQWQPYFQ
view sequence (388 aa)
>Ppa-CEH-22
MEYYSRLAAALEQVLLFSGSGSGPKTRLQKLLLGRTGSNGGGMAPPPSSTGAPSPPPPTSFPSSSQPPALTLHHHPHSMF
TTMDLPKSEIPKWDITPAEAALAQPQLTHWDPQLGVLGYPTLDPSYAYDHSAYLHPSYGLNVPSSSNLINTVPYPQVKNE
PGVAVHSAPSSVFLTNRDASPSQSNASDKIAHDSEMGDEIEDEEEEEDCGDGKKKKRKRRVLFSKGQTYELEKRFRMQRY
LSAPEREQLAQEIRLTPTQVKIWFQNHRYKENTGLGSSILTRTNRYKTKKTDVPVKTSSSPFVPTLQPTPVCALPSSSAF
SPTGNTTKRFPVQMVVRDGKVADSGNYLPQNFGNAGYLPPSSSYGLPMGSYIPTANGQQYAQWQPYFQ
Estimated Isoelectric Point:
8.78903961181641
Estimated Molecular Weight:
42.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys21
Gln22
Leu32
Gly27
Met8
Ser44
Tyr18
His10
Glu19
Arg17
Cys2
Phe12
Pro43
Val18
Asn15
Ala25
Ile9
Trp4
Asp15