Sequence:
download
PP73758sequence.fasta
>Ppa-DOP-3 MSGSSSGWQNVLSMVLPTVPILAIFGNALVMIAVWKERSLQTVTNLLIVSLAVSDLLVALFVMSFGIYFQVNGEWGLGRF VCNIYLASDVMCSTASILNLLAISLDRFMAISHPIVYAQHGMRSSRALISISIVWGLSIAIGLPILLGMNQDENADPNQC GFANPYFNIGSSLLSFFIPCAGMIVLYTVIFKRLKQRERARSQRKATKMENERISSALLGGARFASQMGRHFKNRTDQIL LEISFQTSSFPTLSESSDDHTSSSLNGPLQLPAVTVPVPSPVSPPPAGMSEDADEAEVLLEKDDAGARKSSDSSTIAVQE EERMENGNEDDLSSERIDFGDVYRSFGEHLQELFPFIDSLSRRSSVNNEIEDEEEGSSSSERKEEGRRRRESKRMRKTTL LNEDADNSRPLVDSARSTPMKRSYSKRNGSLPHRGVTASLQNCSLEEARMPIKPVPVQQSSTGLEVPKVHRTVATSSSTP LNGESENNNHKLSSMLEEYSHKTEEDCSKTKSIKKYRDELWKRVTSGWKARPSRQLVKKATKQMRREHKATVTLAVVLAV FLIFWLPFFTLHFTNAWCLILNDNLCIPDPFITVAGWLGYINSSLNPLIYTVFDQRFRNAFKHIICCTSRRR
view sequence (632 aa)
>Ppa-DOP-3
MSGSSSGWQNVLSMVLPTVPILAIFGNALVMIAVWKERSLQTVTNLLIVSLAVSDLLVALFVMSFGIYFQVNGEWGLGRF
VCNIYLASDVMCSTASILNLLAISLDRFMAISHPIVYAQHGMRSSRALISISIVWGLSIAIGLPILLGMNQDENADPNQC
GFANPYFNIGSSLLSFFIPCAGMIVLYTVIFKRLKQRERARSQRKATKMENERISSALLGGARFASQMGRHFKNRTDQIL
LEISFQTSSFPTLSESSDDHTSSSLNGPLQLPAVTVPVPSPVSPPPAGMSEDADEAEVLLEKDDAGARKSSDSSTIAVQE
EERMENGNEDDLSSERIDFGDVYRSFGEHLQELFPFIDSLSRRSSVNNEIEDEEEGSSSSERKEEGRRRRESKRMRKTTL
LNEDADNSRPLVDSARSTPMKRSYSKRNGSLPHRGVTASLQNCSLEEARMPIKPVPVQQSSTGLEVPKVHRTVATSSSTP
LNGESENNNHKLSSMLEEYSHKTEEDCSKTKSIKKYRDELWKRVTSGWKARPSRQLVKKATKQMRREHKATVTLAVVLAV
FLIFWLPFFTLHFTNAWCLILNDNLCIPDPFITVAGWLGYINSSLNPLIYTVFDQRFRNAFKHIICCTSRRR
Estimated Isoelectric Point:
8.56206512451172
Estimated Molecular Weight:
70.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys28
Gln20
Leu63
Gly32
Met18
Ser78
Tyr11
His12
Glu41
Arg45
Cys10
Phe28
Pro30
Val40
Asn32
Ala40
Ile37
Trp9
Asp27