Sequence:
download
PP69087sequence.fasta
>Ppa-TAF-1 MEYSYFYMDDNSMGEVSMDGFEDPNVINNSEDEYTDYYKNHPSAVNQPYLPPPDEIEDDEEEGEVNRSDYFPRPLSPFIP PSKRKDAPLASILDPSLNSIDPRRFFPDFRPGAILRFSRLFSSNIKSSSKAEIWWGSKTYHKRMNDEEKHKEHGHKKKKE FNVLLGSSNDESIIDQEGVFIRTVCKKESNSRKSAHLSESSHPWRFGPAKMWYDMLGVATTAASCSYGLPSEEGTTKKEK ESELHENTNEREKGEEATNPEMFLPYNLMHWEDQIVMDGDLIKHKIIDELKNGKQPRGGWIPTQNLRTYEAFMNALKSNN VEQVLNLRTANNMPDATESSSYHPSSSYSIFPMENNEIMTSNWEEQVIWEDDDLRKLCDPKILTVDLFDDPVLFGMPEDR GLDELDLSDPKRALDRKEMQYTKKSKMILGQVAQRQKQEEEEQMESSIAQMSDRDAFNLSCDDYYMPKAVTKSGNALSTL IQHSIPAQNIHRTFFPTHLTPYKLRHWHRMQLSKRILKQVGGKYVQIQTLARYIRKVSEQREKAKAAEGGGEIFFMRDVG DLSGKDGDLLLMEYSEEHPILLSQPGMASRIRNYHKRKSAKDADPQLDFGELAFAHNSPFLGQVSPGQTLQSLENNLFRA PIHRHKGSRRDFLLIRTKQGYFIRRCPPLFLVGQQSPLFEVPSPNSKRATLFVRDFLMAFIYRLFWASNETPRRLKMEDI KAAFPHYAESSVRKRLKVCSDFKRLGAGMDQNYWILRSDFRLPTKEEVLAMVTPEMCCAQYSMLAAEQRLKDAGYGEKYF FTPEEGDDDDDQVTMEDEIKCAPWNTSRAFLSALKGKCLLDQSGIADPTGGGLGFSFVRVSSKPHKEDVPQVPKRLVTGT NADLRKLPLKEAKEMCRDYGVREEEINALSRWEIIDVIRTLSTQAAKNKKEGEGGGGIGGGGGGGGGGSASMARFARGNI RFNLADMQEKYKKHCQHIFDLQNSVLANGEELSTDEGSSGEESDNEELANRLESMLSAAKGKKGISGERERMEREDEEKE RRDLKRMLYGENIKGEAKTDPSEMEMKFAENSGKDIADSAAKISGLKANQKLKIFRTYQNSDGSESTRVEVITRPQLIEA YTRIRVTKDDTFIQVYAQMDEQFKEERRKEKRRLQDQLRRLKRNEQKVKTGTPQPPKKPTKPLNPNLAKMRCSACGGTGH MKTNKYCPLYGKRGRGLSEGMGITNTDDEMSQPAPSGELVAVEGTKLKISKKIYQHAEQMKRDSMRVNIPRTIIEKREEE DGDEDMDDEMDMDESMMGMDDDEDDEPMNDSRFSSMGKRRSTWIGEEAEYLTGPSKSVHRMRADPKVTFATQLTDIINEL KLVDGSEHLMSAVNGRKIKDYYDIVKKPMDLQKIKMRISNNQYELRMAFLEDVKQMMENSLLYNGPNHVITETARRMFDI AYKKIMEREKEFIRLEKAINPLLDENDRVGFSFILEEILQKCKNIPKSVPFHTKVDARKAAGYYDRISRPMDLGTMEKKV KEYQYQYVKEFLADIQQIYTNSEVYNGPPEKSSYTAKALEIKEMATSLIEEKRGQLDELERNILRRMGIAIDYDDEMSGM SMGEEEREEEMDEDTMMAQDLALSGDDDDEHDDEDEDQFMQMNESQWAKRLEGSSMQMAGQLNADLAMSDSDDDDNSIHS SLFDCLSMEEWRSYTTLSSQEKRKDMGPPSDSLRFVSSPRGGNELTQKAFEIITISTLQRKELEKMRKEEYPTETEEDWL NSLQSWKSKRNSTLERRKDSARDHIKSSLSDSIEKGRESGLGSSLFSPNGESFSSPSSNYVLTNYYSHPNEPEKEKEISE LDQVLIQLQLLREKKEKGEQKDVPSRFTPPLSHNVGKTSWTDVNLDIDKKETSNVSATLHYSPREIESMTRVEPPRNSFN ESKKLEKDAIGHEKMKKPTRMIVDIGIDDPPSSSLFSSNLRSSYRSSTLNPITPPISLPISNLYPPSFESSFSGGGMRMY GSLPRRKDNDYRVISVDEKKGPGKLTDFVPDVDRGRDNENGMTRGIRRDEEPLLIRNYYVLPISPIANRSQYKTIDDFDP QPMKTIDNYSTLPSKWSTPTASQGIGRSAQRVEEIMERREREVEMSDGTIHLEINEIVSTEIITPLEWLSVTQRQKLATP GVKKSGRNLVRKEFASELQEKIVKKMEAEEKSVKENKRVEERGINTIRVAVRGRKFNWMEVDLNAFLATILLLFQSDNFS LKRAKRGAVVTLEKDKWPGGRIPYVLSAAYTQAQRAVFARAIAAYSSRTCIRFVPKQPNDRDYIVISKLDGCYADFARVG GRQQVSLADECIDYATIVHEFMHVIGFIHEHQREDRDSFVKILWPNVLPGANTDFDKLTGLGLSYYGEQYDYFSLMHYES NEGSRNGRNTIEATNPSYTNLMGKSTDFSRSDLNRINRAYQCHSFLNGFNRKLPSRKVLKGVNRGFTRFPIRRG
view sequence (2474 aa)
>Ppa-TAF-1
MEYSYFYMDDNSMGEVSMDGFEDPNVINNSEDEYTDYYKNHPSAVNQPYLPPPDEIEDDEEEGEVNRSDYFPRPLSPFIP
PSKRKDAPLASILDPSLNSIDPRRFFPDFRPGAILRFSRLFSSNIKSSSKAEIWWGSKTYHKRMNDEEKHKEHGHKKKKE
FNVLLGSSNDESIIDQEGVFIRTVCKKESNSRKSAHLSESSHPWRFGPAKMWYDMLGVATTAASCSYGLPSEEGTTKKEK
ESELHENTNEREKGEEATNPEMFLPYNLMHWEDQIVMDGDLIKHKIIDELKNGKQPRGGWIPTQNLRTYEAFMNALKSNN
VEQVLNLRTANNMPDATESSSYHPSSSYSIFPMENNEIMTSNWEEQVIWEDDDLRKLCDPKILTVDLFDDPVLFGMPEDR
GLDELDLSDPKRALDRKEMQYTKKSKMILGQVAQRQKQEEEEQMESSIAQMSDRDAFNLSCDDYYMPKAVTKSGNALSTL
IQHSIPAQNIHRTFFPTHLTPYKLRHWHRMQLSKRILKQVGGKYVQIQTLARYIRKVSEQREKAKAAEGGGEIFFMRDVG
DLSGKDGDLLLMEYSEEHPILLSQPGMASRIRNYHKRKSAKDADPQLDFGELAFAHNSPFLGQVSPGQTLQSLENNLFRA
PIHRHKGSRRDFLLIRTKQGYFIRRCPPLFLVGQQSPLFEVPSPNSKRATLFVRDFLMAFIYRLFWASNETPRRLKMEDI
KAAFPHYAESSVRKRLKVCSDFKRLGAGMDQNYWILRSDFRLPTKEEVLAMVTPEMCCAQYSMLAAEQRLKDAGYGEKYF
FTPEEGDDDDDQVTMEDEIKCAPWNTSRAFLSALKGKCLLDQSGIADPTGGGLGFSFVRVSSKPHKEDVPQVPKRLVTGT
NADLRKLPLKEAKEMCRDYGVREEEINALSRWEIIDVIRTLSTQAAKNKKEGEGGGGIGGGGGGGGGGSASMARFARGNI
RFNLADMQEKYKKHCQHIFDLQNSVLANGEELSTDEGSSGEESDNEELANRLESMLSAAKGKKGISGERERMEREDEEKE
RRDLKRMLYGENIKGEAKTDPSEMEMKFAENSGKDIADSAAKISGLKANQKLKIFRTYQNSDGSESTRVEVITRPQLIEA
YTRIRVTKDDTFIQVYAQMDEQFKEERRKEKRRLQDQLRRLKRNEQKVKTGTPQPPKKPTKPLNPNLAKMRCSACGGTGH
MKTNKYCPLYGKRGRGLSEGMGITNTDDEMSQPAPSGELVAVEGTKLKISKKIYQHAEQMKRDSMRVNIPRTIIEKREEE
DGDEDMDDEMDMDESMMGMDDDEDDEPMNDSRFSSMGKRRSTWIGEEAEYLTGPSKSVHRMRADPKVTFATQLTDIINEL
KLVDGSEHLMSAVNGRKIKDYYDIVKKPMDLQKIKMRISNNQYELRMAFLEDVKQMMENSLLYNGPNHVITETARRMFDI
AYKKIMEREKEFIRLEKAINPLLDENDRVGFSFILEEILQKCKNIPKSVPFHTKVDARKAAGYYDRISRPMDLGTMEKKV
KEYQYQYVKEFLADIQQIYTNSEVYNGPPEKSSYTAKALEIKEMATSLIEEKRGQLDELERNILRRMGIAIDYDDEMSGM
SMGEEEREEEMDEDTMMAQDLALSGDDDDEHDDEDEDQFMQMNESQWAKRLEGSSMQMAGQLNADLAMSDSDDDDNSIHS
SLFDCLSMEEWRSYTTLSSQEKRKDMGPPSDSLRFVSSPRGGNELTQKAFEIITISTLQRKELEKMRKEEYPTETEEDWL
NSLQSWKSKRNSTLERRKDSARDHIKSSLSDSIEKGRESGLGSSLFSPNGESFSSPSSNYVLTNYYSHPNEPEKEKEISE
LDQVLIQLQLLREKKEKGEQKDVPSRFTPPLSHNVGKTSWTDVNLDIDKKETSNVSATLHYSPREIESMTRVEPPRNSFN
ESKKLEKDAIGHEKMKKPTRMIVDIGIDDPPSSSLFSSNLRSSYRSSTLNPITPPISLPISNLYPPSFESSFSGGGMRMY
GSLPRRKDNDYRVISVDEKKGPGKLTDFVPDVDRGRDNENGMTRGIRRDEEPLLIRNYYVLPISPIANRSQYKTIDDFDP
QPMKTIDNYSTLPSKWSTPTASQGIGRSAQRVEEIMERREREVEMSDGTIHLEINEIVSTEIITPLEWLSVTQRQKLATP
GVKKSGRNLVRKEFASELQEKIVKKMEAEEKSVKENKRVEERGINTIRVAVRGRKFNWMEVDLNAFLATILLLFQSDNFS
LKRAKRGAVVTLEKDKWPGGRIPYVLSAAYTQAQRAVFARAIAAYSSRTCIRFVPKQPNDRDYIVISKLDGCYADFARVG
GRQQVSLADECIDYATIVHEFMHVIGFIHEHQREDRDSFVKILWPNVLPGANTDFDKLTGLGLSYYGEQYDYFSLMHYES
NEGSRNGRNTIEATNPSYTNLMGKSTDFSRSDLNRINRAYQCHSFLNGFNRKLPSRKVLKGVNRGFTRFPIRRG
Estimated Isoelectric Point:
5.87383270263672
Estimated Molecular Weight:
283.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr109
Lys191
Gln92
Leu187
Gly151
Met95
Ser215
Tyr81
His45
Glu228
Arg176
Cys21
Phe89
Pro123
Val98
Asn116
Ala126
Ile132
Trp24
Asp175