Sequence:
download
PP69074sequence.fasta
>Ppa-UAF-2 MCSTSSTALSSPGGRSASSVPLSSTTLIDSGSSPVWNTGYDRSEDTDVVGRLEVLLEHGAQRGVIAVPGTKWCINETMGE RFHYDRSDGLSGAEYLASIYGTEKDRVNCSFYFKIGACRHGDKCSRQHHVPTFSPTVLLKNFYHNPVVDVRLADAFDKVG KLNSQEQEYFDAFYEELFTECERKYGEIDEINVCENIGEHMVGNVYVKFMREEDADKALEDLNNNRWFNGAPIYAELSPV TDFREGRCRQHEVSTCNKGGFCNFMHLKAISTDLGQRLYGRRGRRADAAGHWARDQRGGGGGGGFGGGGGRRDDYDRRDR DRGGYGGDRRRDDRGGGRDRRRSRSPRRRSVSSSYHAQMSLVSNFPHNKKRTLYVGGFAEEVNEKVLMGAFIPFGDVVAI SIPMDYETGTHRGFGFVEFELPEDAAAAIDNMNESELFGRTIRVNFARPPKASEQSSRPVWADEEWLRKYGGASANNDDE ADENSRVPRGVKSGPVLPKVYLGVKIGIRHVGRIVIELRTDVVPRTAENFRCLCTGERGYGYEGSSFHRIIPKFMLQGGD FTKGDGTGGKSIYGTKFTDENFKLKHTMPGTVSMANCGPDTNGSQFFICTERTEWLDGKHVVFGYVVEGMNVVRQIEQQG SATGKPNMVVKIVECGELEAEKRRAAEKAAVAEERAAAGLVEADAAEGAEPAAAAAAAEKRVLQVP
view sequence (706 aa)
>Ppa-UAF-2
MCSTSSTALSSPGGRSASSVPLSSTTLIDSGSSPVWNTGYDRSEDTDVVGRLEVLLEHGAQRGVIAVPGTKWCINETMGE
RFHYDRSDGLSGAEYLASIYGTEKDRVNCSFYFKIGACRHGDKCSRQHHVPTFSPTVLLKNFYHNPVVDVRLADAFDKVG
KLNSQEQEYFDAFYEELFTECERKYGEIDEINVCENIGEHMVGNVYVKFMREEDADKALEDLNNNRWFNGAPIYAELSPV
TDFREGRCRQHEVSTCNKGGFCNFMHLKAISTDLGQRLYGRRGRRADAAGHWARDQRGGGGGGGFGGGGGRRDDYDRRDR
DRGGYGGDRRRDDRGGGRDRRRSRSPRRRSVSSSYHAQMSLVSNFPHNKKRTLYVGGFAEEVNEKVLMGAFIPFGDVVAI
SIPMDYETGTHRGFGFVEFELPEDAAAAIDNMNESELFGRTIRVNFARPPKASEQSSRPVWADEEWLRKYGGASANNDDE
ADENSRVPRGVKSGPVLPKVYLGVKIGIRHVGRIVIELRTDVVPRTAENFRCLCTGERGYGYEGSSFHRIIPKFMLQGGD
FTKGDGTGGKSIYGTKFTDENFKLKHTMPGTVSMANCGPDTNGSQFFICTERTEWLDGKHVVFGYVVEGMNVVRQIEQQG
SATGKPNMVVKIVECGELEAEKRRAAEKAAVAEERAAAGLVEADAAEGAEPAAAAAAAEKRVLQVP
Estimated Isoelectric Point:
6.33013153076172
Estimated Molecular Weight:
77.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys32
Gln15
Leu35
Gly82
Met14
Ser46
Tyr23
His17
Glu57
Arg63
Cys15
Phe33
Pro27
Val53
Asn30
Ala56
Ile25
Trp7
Asp44