Sequence:
download
PP69055sequence.fasta
>Ppa-ITR-1 MIISRVAAQVPHSVFLAPNPKPSQCWSGIWLGARSAPPSGIATETMEIEESGREEDCLSLCLGLSRSERAVRAVIEVSRI VTDKQAVRLNGPRDCRNEGESGDEKADERQPTHERRKRFLQAIRITSCSSELVSGRHTLGRPHLGCATCRIRDQEQEAAR LQQLQQLEDRRRLQQLQHLAVLLSGSRISPLVVGSDHWNALKMVKMKAAVTSISFADMLMNRKMTMNQSTDGFSGGNTSL LHIGDIISLYTDDGDHRGFLSTLGLVDDRCLVEIGDGRPESPPKKFRDCLFKVCPVNRYAAQKQYWTEQKRFSEKEQNEL EFRKSLGTAIQYGTTIQLLHVKSDKFVTVQRNSPAKLERNAMKVYLDRAGNEGSWFVVEPAYKHYVIGDNVAAGNKVSLV PYTAGKEIANHSVKHQLHLSHLRLPDHPRAAEVNCLNEVTEWQVFMFLLYDENRPDVVKSGDVIRLFHADQQTFLTLDTV PKTKQDVVFLRMTNRPSAADATSSRALWEVQVVQKDAFRGGSAHYRDFYRFKHLATDMYLTAVANTGPKPQTGTGLRRPS LAMTKLHPNGVSLPRGAETPEQSADNTYVLTPANYDFVETEKNTMFSLEPSTITKSKDVVTRSFVRIYHNESTSWVHATS PGNKDNLYFSSKTEKGWVKLIGEKARLDKETFALLPVSPNEVRDLDFANDACEALSGFFSLIRSGKVVSKEPLNNVIQLL TECIFFVMNCSNHLADPFKISSETKPSRDRQKLLREQLVLDEVFKLLKAPFMPRQGVTELGPLLNSPHDLNEQRNEVFKT MFQLCYSLLRYSQIGYRKNQEFLAEKFGQIQEQIGFDLMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFL DYLADLCVCRGEANKKIQELICTSVLSEANRNIFMETLLVDGEVWIQWQGEKKKLVEIALMCQEQQYLAIDPPPERKLMN LSRELPAELVLVCMSNHRLPHELRASFTRLMLHLHVVRGSPLTAIRHARLWRDIPDDVTVSSYRTRIVEGYADGGRVRVG DEISTAILKTVDDYVGLLRRTRIDGVVLESDSSAIMRNKLTYEIVNLARWLATFGFYSFEHLLSLSRNLLAIVDTTPPPP ITNVVAAQNITTGVGMIHRVTRGMLSQSSAQDPTPLQPKSPLEVKARGRESMQLIMNTKLIVAEILQFVMDVRRDYRITV VLSWFKKRFPCDENGELEVSARIDERMAKELCDGVYNNSEGELNLDGEDGQRLLAILLQMTMSDYDLLTSIALKALFRHF TQYQELLDDLKQVQLLVSNDDVENYRQVDRDLFILRNLTEKSELWVQGGGHAGSSSSSSTEKEDQSSKSKQDDTLRHQRA FSNDDSRKVLVEIIDKHYPSIREDCYKLLNILLVGEDRDACSQALQELSDRAPLIAYPIIRQIMVRIKQLCYKEAKPDAM NQQLLRNMRVYEVVLEFLSIPYDKKNDTEMPKLITLSHEFLRSFCKNNRENQNRLHKFVSIEKDAKEGMFRVETVEEVAT LNTFFRNNRELCQNVSEELIAHIVNLIEHKSRNATFLEFLSSIVCVFEKEIEATQEKVAQEICAASDEVRQLYVDNASFE QLEEMMRDAPPYLDNGHPLKYHLELVRLLALCTRGKNGSTELKCASELPMDHIVRVVTSPYCLIEVKMAYVQFLLHCYID TDAEMKDAYRPEYIEALLSNFLGDIKKMKEEMSKPVSSELVSLEQYVCHVMTDILIKFFEKPFNDQPKIDVQQHQKLFVL LLGSLGNLQTGWLRKNPKSTKNWYRVAECTKRLSRCAEERNLSIPANVAMPPMPTAATAKQRWQSAALSSRFIRINQQTL SVRNRANSLLAMGANSTVDQSANVVTCYHMMVGEFKYYLLPLHAAEGSILVDVLHVPQLLFPPGSDLRDQCAAGGVVSKL IQHCKTLMLGKSDNLCVRVLQTLCKMASDTKYAFNDQGQRLRRKLLDRYFGRYGSEHLGTTKRNTLGLTRQASKLSDSDD DGLNFDPSLFNSFKLYDVQCKLNDAGASDLVIDIIVNDPNYEIFLKAFQLAKALLHEGNDKVQQSFYDRLKQKDVHEPFF RAISSRLQTAQTRLKSDMMQCIDTRPKGGASTTSIPASAVLLTPTQEKAMLFHSPSLDAGRLTTIQENGAGGGAAGGQPG TSQGGASGGAAMVSAAQEDMTPYEDDEDGKKKNVLPQEVAIVEPILRVLQLLCENHNSLLQNFIRRQSDRANHNLVSETL SFLDTVCGSTKGSLGVFKEIGEHNFSLITQTLSTLTEFCQGPCHENQNTMAMQENGLNIIISLVLNDIKPLADEHMELAL EIKSSASKLLLSIMESRHDGENAERVLRNMSNMAGGPKQLIHAMTQAYAMANSPELIVSRMRRQLMDQAVSAATPGGAIR SLVHPQIKTETLTLPEISVNASGTVSIKEDTKFDDRLLKEESSSTIIDPREVGHNIYILAHQLSRHSNELAACLDVNDES KDEQTREALLYYKQHTAQIEIVREDRSLERVVFPIHDICSYVTRETKSNVYFETERDAQGSKVTDFFGRWPELYDEMRWQ HKLQTWPWLSHCARRLKLWSRFSNFFAVLVNAIIAFYYPFEDSVSTLASNPGMTMNKAIHLTSYISNRGLYDKTWGERIV DTTFYYHSAYFICCILGITVHPFLYAFLLYDIVASDETLRSVISSVTRNWQSIILTGLLALFLVYQFSIVGFVFFQKDFR IEVDRLDGPPDPLTISIGADNNDPPQCASPGDECPTPETAVAAGKDDEDDKVFACNSLRMCIVTTLNWGLRNGGGIGDVL RNVAPDEPLFHFRVFYNLAFYVVLIEPLFHFRVLYDLAFYVVLIVIVLNLIFGVIIDTFGDLRTEKNEKEDILNNTCFIC ALERGRFDNRAVTFEEHRRKEHNLWHYLYFIVWLQIKDETEFTGPESYVSQCIKDRNLDWFPRMQAISLEEETAESEQPE TAALKKEIVTLNHCVRDLRDQLEDIRQQLQYIDMMRELLCKTRLSSSKSAPPGIIDLNGSLRLTNKDKALAFSKYFAFVS TLPMQAPLRPSVPSPTIPLFDLPSISPAQILAGVASLAPKCNFSPDCLPNIFYAKCKFSIVSPLLIIFNKSLHSKSIPKQ AIVKPIPKTSSTLERW
view sequence (3136 aa)
>Ppa-ITR-1
MIISRVAAQVPHSVFLAPNPKPSQCWSGIWLGARSAPPSGIATETMEIEESGREEDCLSLCLGLSRSERAVRAVIEVSRI
VTDKQAVRLNGPRDCRNEGESGDEKADERQPTHERRKRFLQAIRITSCSSELVSGRHTLGRPHLGCATCRIRDQEQEAAR
LQQLQQLEDRRRLQQLQHLAVLLSGSRISPLVVGSDHWNALKMVKMKAAVTSISFADMLMNRKMTMNQSTDGFSGGNTSL
LHIGDIISLYTDDGDHRGFLSTLGLVDDRCLVEIGDGRPESPPKKFRDCLFKVCPVNRYAAQKQYWTEQKRFSEKEQNEL
EFRKSLGTAIQYGTTIQLLHVKSDKFVTVQRNSPAKLERNAMKVYLDRAGNEGSWFVVEPAYKHYVIGDNVAAGNKVSLV
PYTAGKEIANHSVKHQLHLSHLRLPDHPRAAEVNCLNEVTEWQVFMFLLYDENRPDVVKSGDVIRLFHADQQTFLTLDTV
PKTKQDVVFLRMTNRPSAADATSSRALWEVQVVQKDAFRGGSAHYRDFYRFKHLATDMYLTAVANTGPKPQTGTGLRRPS
LAMTKLHPNGVSLPRGAETPEQSADNTYVLTPANYDFVETEKNTMFSLEPSTITKSKDVVTRSFVRIYHNESTSWVHATS
PGNKDNLYFSSKTEKGWVKLIGEKARLDKETFALLPVSPNEVRDLDFANDACEALSGFFSLIRSGKVVSKEPLNNVIQLL
TECIFFVMNCSNHLADPFKISSETKPSRDRQKLLREQLVLDEVFKLLKAPFMPRQGVTELGPLLNSPHDLNEQRNEVFKT
MFQLCYSLLRYSQIGYRKNQEFLAEKFGQIQEQIGFDLMAEDTMTAVLHNNPKLLEKYVKTPHVERFVELVRNNRQGKFL
DYLADLCVCRGEANKKIQELICTSVLSEANRNIFMETLLVDGEVWIQWQGEKKKLVEIALMCQEQQYLAIDPPPERKLMN
LSRELPAELVLVCMSNHRLPHELRASFTRLMLHLHVVRGSPLTAIRHARLWRDIPDDVTVSSYRTRIVEGYADGGRVRVG
DEISTAILKTVDDYVGLLRRTRIDGVVLESDSSAIMRNKLTYEIVNLARWLATFGFYSFEHLLSLSRNLLAIVDTTPPPP
ITNVVAAQNITTGVGMIHRVTRGMLSQSSAQDPTPLQPKSPLEVKARGRESMQLIMNTKLIVAEILQFVMDVRRDYRITV
VLSWFKKRFPCDENGELEVSARIDERMAKELCDGVYNNSEGELNLDGEDGQRLLAILLQMTMSDYDLLTSIALKALFRHF
TQYQELLDDLKQVQLLVSNDDVENYRQVDRDLFILRNLTEKSELWVQGGGHAGSSSSSSTEKEDQSSKSKQDDTLRHQRA
FSNDDSRKVLVEIIDKHYPSIREDCYKLLNILLVGEDRDACSQALQELSDRAPLIAYPIIRQIMVRIKQLCYKEAKPDAM
NQQLLRNMRVYEVVLEFLSIPYDKKNDTEMPKLITLSHEFLRSFCKNNRENQNRLHKFVSIEKDAKEGMFRVETVEEVAT
LNTFFRNNRELCQNVSEELIAHIVNLIEHKSRNATFLEFLSSIVCVFEKEIEATQEKVAQEICAASDEVRQLYVDNASFE
QLEEMMRDAPPYLDNGHPLKYHLELVRLLALCTRGKNGSTELKCASELPMDHIVRVVTSPYCLIEVKMAYVQFLLHCYID
TDAEMKDAYRPEYIEALLSNFLGDIKKMKEEMSKPVSSELVSLEQYVCHVMTDILIKFFEKPFNDQPKIDVQQHQKLFVL
LLGSLGNLQTGWLRKNPKSTKNWYRVAECTKRLSRCAEERNLSIPANVAMPPMPTAATAKQRWQSAALSSRFIRINQQTL
SVRNRANSLLAMGANSTVDQSANVVTCYHMMVGEFKYYLLPLHAAEGSILVDVLHVPQLLFPPGSDLRDQCAAGGVVSKL
IQHCKTLMLGKSDNLCVRVLQTLCKMASDTKYAFNDQGQRLRRKLLDRYFGRYGSEHLGTTKRNTLGLTRQASKLSDSDD
DGLNFDPSLFNSFKLYDVQCKLNDAGASDLVIDIIVNDPNYEIFLKAFQLAKALLHEGNDKVQQSFYDRLKQKDVHEPFF
RAISSRLQTAQTRLKSDMMQCIDTRPKGGASTTSIPASAVLLTPTQEKAMLFHSPSLDAGRLTTIQENGAGGGAAGGQPG
TSQGGASGGAAMVSAAQEDMTPYEDDEDGKKKNVLPQEVAIVEPILRVLQLLCENHNSLLQNFIRRQSDRANHNLVSETL
SFLDTVCGSTKGSLGVFKEIGEHNFSLITQTLSTLTEFCQGPCHENQNTMAMQENGLNIIISLVLNDIKPLADEHMELAL
EIKSSASKLLLSIMESRHDGENAERVLRNMSNMAGGPKQLIHAMTQAYAMANSPELIVSRMRRQLMDQAVSAATPGGAIR
SLVHPQIKTETLTLPEISVNASGTVSIKEDTKFDDRLLKEESSSTIIDPREVGHNIYILAHQLSRHSNELAACLDVNDES
KDEQTREALLYYKQHTAQIEIVREDRSLERVVFPIHDICSYVTRETKSNVYFETERDAQGSKVTDFFGRWPELYDEMRWQ
HKLQTWPWLSHCARRLKLWSRFSNFFAVLVNAIIAFYYPFEDSVSTLASNPGMTMNKAIHLTSYISNRGLYDKTWGERIV
DTTFYYHSAYFICCILGITVHPFLYAFLLYDIVASDETLRSVISSVTRNWQSIILTGLLALFLVYQFSIVGFVFFQKDFR
IEVDRLDGPPDPLTISIGADNNDPPQCASPGDECPTPETAVAAGKDDEDDKVFACNSLRMCIVTTLNWGLRNGGGIGDVL
RNVAPDEPLFHFRVFYNLAFYVVLIEPLFHFRVLYDLAFYVVLIVIVLNLIFGVIIDTFGDLRTEKNEKEDILNNTCFIC
ALERGRFDNRAVTFEEHRRKEHNLWHYLYFIVWLQIKDETEFTGPESYVSQCIKDRNLDWFPRMQAISLEEETAESEQPE
TAALKKEIVTLNHCVRDLRDQLEDIRQQLQYIDMMRELLCKTRLSSSKSAPPGIIDLNGSLRLTNKDKALAFSKYFAFVS
TLPMQAPLRPSVPSPTIPLFDLPSISPAQILAGVASLAPKCNFSPDCLPNIFYAKCKFSIVSPLLIIFNKSLHSKSIPKQ
AIVKPIPKTSSTLERW
Estimated Isoelectric Point:
6.41109466552734
Estimated Molecular Weight:
355.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr168
Lys170
Gln145
Leu349
Gly148
Met76
Ser233
Tyr85
His79
Glu211
Arg199
Cys64
Phe131
Pro138
Val211
Asn146
Ala205
Ile166
Trp30
Asp182