Sequence:
download
PP63653sequence.fasta
>Ppa-NRX-1 MKKQPPDDVRWPPTLSTPYTLSSIRENERVRESERGRAPFRLLVLLLMIGSMEGGEGVILTGGPNSYARYPKWMHSFDNT INLELKTKQSNGLIFYQDDGNVNGNFHCLSIVDGILTLDFRLGDDSNDFGTRRLVYSIRVEEVRVDDDRWHAVTIHFHWE NLKLTMDNAYGFSIMNQRSTGFGDLGKSSDVFVGGVPKDLHILPVMSSPLRRYTRNLAGNIRNLVYRQYPQGMSSPSLIE GQGIRQNDDDYCRPAAVSSRESFKCLHGGKCYSSNEGARCDCTETSFEGKVCESEKPDGELSLKGQEWVGYDTEKYNGGV IRTKRENVTLQFKTVHGSAMLFFAGDDQNFLHLGIEDGAMIATSKFAGSDARMVRIFNVLPTSRYDDDTWHTIVLERNLR MMTLTVDGRRDEISQYAPETEWISHSFAYVGGTPKDRSYSAAVSRTPFRGCLKTVIYRSAAIALPFVQLSDRGFGLSLMR TGGELSFSCSSPSAPPDVLSFLKADVHSHIHLPKWNAMNSGTLSFHLRPLDNDGLVLFHGTTQGGDDYVAFELIDGHLFL VLNLGSGAVRLQTTAHRLTEGHSWHSVQLERQGRNGHVIVDNIKTDFSTPGVSANLIIDDPIFLGGVPANANLQFPSAVW SIGLRKGFVGCIKNVRFNGITSKISAAFEAQNTTGITVGCSLPPSPVDHCSTSPCQNFGHCENAFGTFKCDCAHTNMEGL TCAQDPIPIDVDGQSPILLTLPRAYSSEAESVELRFKTDTATGTLLDTRCLSNSTSRLRIALINAQLQLELNFGTGKHTF KWGSKLNDKQMHTIRVKRRGEKLLLYLDGKWESVYFLPSKTLVLEMDEISAGHSLTTGDKSGPIDESFQGQLYTAVVNDY DLLEKPKKEGVMTHSHSPKAPKALKHQSLSFSNASGYARLPSTISDTLPGPFRISLKFQTLIRHALLLATVAHETRNDAL SIEIINGRIKYTYRSPTHEHSVLTPTLPHEKHLADMRWHALLIYQDPKSFEHIIMVDNTTTHLAVKERKRAKISGDIWIG GLSPTSKPPKLASIPSYRGCISSIRLHDEAIDVWDEVVEKSEVGRGCSGPIARCSPTACSNGGRCIQQWSSILCDCTITG HSGSRCQQAGTTYEFPSSPSAIIMEYADGARPSTKKDLVVLSFKTHSSSGVLLAVQCTGATDFLTLYIDGGMVNTKWNLG SGEHHMTLHHRKVDDNKWHTVKMLRSDENMTIALDQLPGIRYTPSDSAGLITLDMQSRVFLGAAPDARHVISGKRRKRSV NPPLFDTYSGSIAGVNYNGNMVLDMLAHGDPSIRVIGEVKQSYLAAEPEKKEAIMNEYMESSHALIESIGAASPWMVSLP PSDLHLITSTVLPILCLVDWSSPKCKLAAPPRFAAVFDAGRHAARLATPPPPPMTIPVKSTPPWKVPTTERPTRGKQKMR RPTTARIEERGRTSAEFDDEQEDDGFFTPVLTSVHTRRPQSPSTTSTTSTPSTTTSTTGKPTTTTTESTTTSTTTTTTEA PSTTTSTSTTMRTTTTSSVVYLEQFPGEEGSADLPEGVAVGVTEAAPPLALAATPATTAGTVLPRPYSSMEEAARLNPEY VDAALSVWNEAEVVQKEASRRPITTTSTTTKKPSTASTSTTTRRPQTTTTSKGERLPLLMKCSGVNA
view sequence (1667 aa)
>Ppa-NRX-1
MKKQPPDDVRWPPTLSTPYTLSSIRENERVRESERGRAPFRLLVLLLMIGSMEGGEGVILTGGPNSYARYPKWMHSFDNT
INLELKTKQSNGLIFYQDDGNVNGNFHCLSIVDGILTLDFRLGDDSNDFGTRRLVYSIRVEEVRVDDDRWHAVTIHFHWE
NLKLTMDNAYGFSIMNQRSTGFGDLGKSSDVFVGGVPKDLHILPVMSSPLRRYTRNLAGNIRNLVYRQYPQGMSSPSLIE
GQGIRQNDDDYCRPAAVSSRESFKCLHGGKCYSSNEGARCDCTETSFEGKVCESEKPDGELSLKGQEWVGYDTEKYNGGV
IRTKRENVTLQFKTVHGSAMLFFAGDDQNFLHLGIEDGAMIATSKFAGSDARMVRIFNVLPTSRYDDDTWHTIVLERNLR
MMTLTVDGRRDEISQYAPETEWISHSFAYVGGTPKDRSYSAAVSRTPFRGCLKTVIYRSAAIALPFVQLSDRGFGLSLMR
TGGELSFSCSSPSAPPDVLSFLKADVHSHIHLPKWNAMNSGTLSFHLRPLDNDGLVLFHGTTQGGDDYVAFELIDGHLFL
VLNLGSGAVRLQTTAHRLTEGHSWHSVQLERQGRNGHVIVDNIKTDFSTPGVSANLIIDDPIFLGGVPANANLQFPSAVW
SIGLRKGFVGCIKNVRFNGITSKISAAFEAQNTTGITVGCSLPPSPVDHCSTSPCQNFGHCENAFGTFKCDCAHTNMEGL
TCAQDPIPIDVDGQSPILLTLPRAYSSEAESVELRFKTDTATGTLLDTRCLSNSTSRLRIALINAQLQLELNFGTGKHTF
KWGSKLNDKQMHTIRVKRRGEKLLLYLDGKWESVYFLPSKTLVLEMDEISAGHSLTTGDKSGPIDESFQGQLYTAVVNDY
DLLEKPKKEGVMTHSHSPKAPKALKHQSLSFSNASGYARLPSTISDTLPGPFRISLKFQTLIRHALLLATVAHETRNDAL
SIEIINGRIKYTYRSPTHEHSVLTPTLPHEKHLADMRWHALLIYQDPKSFEHIIMVDNTTTHLAVKERKRAKISGDIWIG
GLSPTSKPPKLASIPSYRGCISSIRLHDEAIDVWDEVVEKSEVGRGCSGPIARCSPTACSNGGRCIQQWSSILCDCTITG
HSGSRCQQAGTTYEFPSSPSAIIMEYADGARPSTKKDLVVLSFKTHSSSGVLLAVQCTGATDFLTLYIDGGMVNTKWNLG
SGEHHMTLHHRKVDDNKWHTVKMLRSDENMTIALDQLPGIRYTPSDSAGLITLDMQSRVFLGAAPDARHVISGKRRKRSV
NPPLFDTYSGSIAGVNYNGNMVLDMLAHGDPSIRVIGEVKQSYLAAEPEKKEAIMNEYMESSHALIESIGAASPWMVSLP
PSDLHLITSTVLPILCLVDWSSPKCKLAAPPRFAAVFDAGRHAARLATPPPPPMTIPVKSTPPWKVPTTERPTRGKQKMR
RPTTARIEERGRTSAEFDDEQEDDGFFTPVLTSVHTRRPQSPSTTSTTSTPSTTTSTTGKPTTTTTESTTTSTTTTTTEA
PSTTTSTSTTMRTTTTSSVVYLEQFPGEEGSADLPEGVAVGVTEAAPPLALAATPATTAGTVLPRPYSSMEEAARLNPEY
VDAALSVWNEAEVVQKEASRRPITTTSTTTKKPSTASTSTTTRRPQTTTTSKGERLPLLMKCSGVNA
Estimated Isoelectric Point:
7.19583892822266
Estimated Molecular Weight:
183.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr158
Lys76
Gln44
Leu146
Gly124
Met37
Ser160
Tyr40
His53
Glu85
Arg99
Cys30
Phe57
Pro101
Val95
Asn59
Ala107
Ile82
Trp22
Asp92