Sequence:
download
PP62462sequence.fasta
>Ppa-LEV-10 MERQEKKKRQARKLRRDFTDHKRANLYPFQCIYTFVAGEGARVKLDFEQFQLAGTSENCEAEYVDIYSELERADENLLFA RLGGRYCGSVSPHVRISLHNILVLVFHSRVGDASVPKLRFKGNYSFIPEARYIPGIAHPPGSKCSFIIDSSQRKRGTIYS PTYPGTYPKNFHCSYLLKGKQGQRIRLMFRDFDIYFGGEHCPYDSVTVYDGDSTSSPIIKKVCGLQQRMEQFSVGPELLI HFNATDPPKADPRGYVIEYEFSSRFVDVNTLLGGESTVFNYRERGVTHMRGTECNVRVESNRETTHYIHSPKYPDLYPAN TTCTYILDGLQGDQNLEKVILTFEEFAVISELSSHVSIDSAMDDTDPDFITCPNAYVGIAINDGNMKATLSSTDESNFDH TLPTTRRSFGTTEKLSVDGKHPLGFKAKIDFKTDFGIPGEPVADSNVCNFRFRSKTGFFNSPRYPANYPLDTNCTYEIIG QEGQMILIHFEQFALEPDDKSCKDFLEIHDIFHDEGGAEDTRLQARYCSNAVPGPRFSAFGSHHMRVFFSSNSAGTGNGF KLLYEMRAALKEEIPGDDGMLIDPRHCGNTTTATDEMTPGYQILLTLLKLDVEGSMKDGVINCQKAVIRVQRENEEQVEL CGQSKEMFKPMLSYNGSIRLSFITAPDKVNGLSGFMFSWTETRVAKDYSECASDSQYLCTYSKLCISAALRCNSNFDCGE DDDTDEGLHCQTKAGDSNWIITSAFVFSGCIFLFIIFVLFYLFKKKLEKKKRRRRRRNNRAVMSTSTRSRSRQPYRGAGH KPPVAGERETIAFDYAPQTAKPKLSKQSASQLGVKPTETNPGRRRDVALRAPRRDGHSPADEADEDDRRHHLLWLTLAGQ DGSTVDALQLATDFGRSCADQDKVIKMIKVFFQDSYLNGSRAIGLVFFPNHSRNGWRKISAPLVPDRTVDGVARRLSKTK PGVCWILLCARVLHTRKSNLSVRYEPGF
view sequence (988 aa)
>Ppa-LEV-10
MERQEKKKRQARKLRRDFTDHKRANLYPFQCIYTFVAGEGARVKLDFEQFQLAGTSENCEAEYVDIYSELERADENLLFA
RLGGRYCGSVSPHVRISLHNILVLVFHSRVGDASVPKLRFKGNYSFIPEARYIPGIAHPPGSKCSFIIDSSQRKRGTIYS
PTYPGTYPKNFHCSYLLKGKQGQRIRLMFRDFDIYFGGEHCPYDSVTVYDGDSTSSPIIKKVCGLQQRMEQFSVGPELLI
HFNATDPPKADPRGYVIEYEFSSRFVDVNTLLGGESTVFNYRERGVTHMRGTECNVRVESNRETTHYIHSPKYPDLYPAN
TTCTYILDGLQGDQNLEKVILTFEEFAVISELSSHVSIDSAMDDTDPDFITCPNAYVGIAINDGNMKATLSSTDESNFDH
TLPTTRRSFGTTEKLSVDGKHPLGFKAKIDFKTDFGIPGEPVADSNVCNFRFRSKTGFFNSPRYPANYPLDTNCTYEIIG
QEGQMILIHFEQFALEPDDKSCKDFLEIHDIFHDEGGAEDTRLQARYCSNAVPGPRFSAFGSHHMRVFFSSNSAGTGNGF
KLLYEMRAALKEEIPGDDGMLIDPRHCGNTTTATDEMTPGYQILLTLLKLDVEGSMKDGVINCQKAVIRVQRENEEQVEL
CGQSKEMFKPMLSYNGSIRLSFITAPDKVNGLSGFMFSWTETRVAKDYSECASDSQYLCTYSKLCISAALRCNSNFDCGE
DDDTDEGLHCQTKAGDSNWIITSAFVFSGCIFLFIIFVLFYLFKKKLEKKKRRRRRRNNRAVMSTSTRSRSRQPYRGAGH
KPPVAGERETIAFDYAPQTAKPKLSKQSASQLGVKPTETNPGRRRDVALRAPRRDGHSPADEADEDDRRHHLLWLTLAGQ
DGSTVDALQLATDFGRSCADQDKVIKMIKVFFQDSYLNGSRAIGLVFFPNHSRNGWRKISAPLVPDRTVDGVARRLSKTK
PGVCWILLCARVLHTRKSNLSVRYEPGF
Estimated Isoelectric Point:
8.20702362060547
Estimated Molecular Weight:
111.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr59
Lys56
Gln32
Leu73
Gly72
Met17
Ser77
Tyr37
His27
Glu56
Arg73
Cys27
Phe59
Pro50
Val52
Asn40
Ala58
Ile51
Trp5
Asp67