Sequence:
download
PP61950sequence.fasta
>Ppa-UNC-31 MLGASSSEEDDEDFIEEHNHNEIPNMKKRSFMASSQRSASPAPSDSVSQCNSIKRDNSARRVMDTPTRAAPNSSRNLSTA SRPMMQSSQDISDTETADVEEVQSVPHEDSHLSKEEQERIRAEAEEEEHKKKLQLYVFVSRCIAYHFNAKQDQPIDAMKR QLKVTKHDLAKIKDRFSAFLRGETQIIADEAFTKAIQSYTEVFLRSERVQKVVQAGGFSQHDFREVFRTNVDKRIRSLPE IDGLSKETVLNSWMTKFDTIIREDDHNSRNRGRLRTTALNSESILSKDQLFDMFQQCLFVKKFEHQIIFNALQLDNPDEQ AAAIRREVTTREDCLREISKMRKVMPKFVVKDMETLFMDEVRQSINLLISNLESVPVTPRGAAIGKRKDNRSRANAKTRS LKRRTSGGSLNKADSDDGEVTLTKSDVVLSFNIEIVVMEVKGLKSIPSNKIVYCMMEVDGQKLQTDHAEASKPSWDTQGD FTTKNILPTVKVKLYTEVNSIVAFEDKELGKVVIQPTPNCSRNPEWYPMTVAKNSQDKDLQIRIAIRVEKPPNLKYCGYC YIMGRTVWKKWKRRFVCLVQVSQYAFAVCTYRQKKSDPTDFFQLEGFTIDYMPEPDIDLVSQGGKHFFTAIKEGDELKFA TDDENERHLWVQALYRATGQAYKPVPPKASLAAPSKQQGFQDKASKHGMDEIIQADMINFNQDHLFEELQKATLTFRLTE SICSLGWFSPGQMFVLDEYCARYMVRGCHRHVSLLSNLLDKMDEGHLIDPTLVHFSFAFCASHVHGNRPDGVGTVTLEEK ERFQEIKERLKVILEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKDVVSPVPPEEVRAVIRKCLEDAALVNYTRICNE AKIEQRMGQDVSPAQRIDDMIRITELCVDLLKENEEHHGEQLRGAFAWFSDLLSDHSEIFWSLYSVDLDAALEVQPGDSW DSFPLFQMLNDFLLNEPTLKHGSFHKKLTEQFQPNVNRYADVMEHSISQSIDKGFSKEKWEPRKDGCTTSEDIYWKLDAL MNFVIDLNWPEEEFRRYLTGRMKNLTSEMITKVANCTFQAFDQWMQRSRKSTDYVLPIEVCVMVNVIFSSKARALRLKMD AGEYKYQSKLDETLETMLKDMETTIQEKLIAVLEFVLGKLSRYDEGNPIGAILSIAPSSMKPNSIFNKMKNLVDTPASTA ASPAKQAVAAPAQSGHIGNNYVTFMRGCSEQLRQVVIDEVWVNRVFEKWYSTQMKMINDWLTDRLQQSLSNYQFTCLSFI VKKVYSDFELQGIDEERLNFKTYQTIQRRMQMEETTCALTETSNGSNGGGLAAGLGNATAAVSNMSSMVEGAGARVFSLF K
view sequence (1361 aa)
>Ppa-UNC-31
MLGASSSEEDDEDFIEEHNHNEIPNMKKRSFMASSQRSASPAPSDSVSQCNSIKRDNSARRVMDTPTRAAPNSSRNLSTA
SRPMMQSSQDISDTETADVEEVQSVPHEDSHLSKEEQERIRAEAEEEEHKKKLQLYVFVSRCIAYHFNAKQDQPIDAMKR
QLKVTKHDLAKIKDRFSAFLRGETQIIADEAFTKAIQSYTEVFLRSERVQKVVQAGGFSQHDFREVFRTNVDKRIRSLPE
IDGLSKETVLNSWMTKFDTIIREDDHNSRNRGRLRTTALNSESILSKDQLFDMFQQCLFVKKFEHQIIFNALQLDNPDEQ
AAAIRREVTTREDCLREISKMRKVMPKFVVKDMETLFMDEVRQSINLLISNLESVPVTPRGAAIGKRKDNRSRANAKTRS
LKRRTSGGSLNKADSDDGEVTLTKSDVVLSFNIEIVVMEVKGLKSIPSNKIVYCMMEVDGQKLQTDHAEASKPSWDTQGD
FTTKNILPTVKVKLYTEVNSIVAFEDKELGKVVIQPTPNCSRNPEWYPMTVAKNSQDKDLQIRIAIRVEKPPNLKYCGYC
YIMGRTVWKKWKRRFVCLVQVSQYAFAVCTYRQKKSDPTDFFQLEGFTIDYMPEPDIDLVSQGGKHFFTAIKEGDELKFA
TDDENERHLWVQALYRATGQAYKPVPPKASLAAPSKQQGFQDKASKHGMDEIIQADMINFNQDHLFEELQKATLTFRLTE
SICSLGWFSPGQMFVLDEYCARYMVRGCHRHVSLLSNLLDKMDEGHLIDPTLVHFSFAFCASHVHGNRPDGVGTVTLEEK
ERFQEIKERLKVILEKQITNFRYCFPFGRPEGALKGTLSLLERVLMKDVVSPVPPEEVRAVIRKCLEDAALVNYTRICNE
AKIEQRMGQDVSPAQRIDDMIRITELCVDLLKENEEHHGEQLRGAFAWFSDLLSDHSEIFWSLYSVDLDAALEVQPGDSW
DSFPLFQMLNDFLLNEPTLKHGSFHKKLTEQFQPNVNRYADVMEHSISQSIDKGFSKEKWEPRKDGCTTSEDIYWKLDAL
MNFVIDLNWPEEEFRRYLTGRMKNLTSEMITKVANCTFQAFDQWMQRSRKSTDYVLPIEVCVMVNVIFSSKARALRLKMD
AGEYKYQSKLDETLETMLKDMETTIQEKLIAVLEFVLGKLSRYDEGNPIGAILSIAPSSMKPNSIFNKMKNLVDTPASTA
ASPAKQAVAAPAQSGHIGNNYVTFMRGCSEQLRQVVIDEVWVNRVFEKWYSTQMKMINDWLTDRLQQSLSNYQFTCLSFI
VKKVYSDFELQGIDEERLNFKTYQTIQRRMQMEETTCALTETSNGSNGGGLAAGLGNATAAVSNMSSMVEGAGARVFSLF
K
Estimated Isoelectric Point:
6.14406585693359
Estimated Molecular Weight:
155.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr74
Lys97
Gln70
Leu107
Gly58
Met46
Ser108
Tyr31
His28
Glu105
Arg82
Cys24
Phe67
Pro51
Val90
Asn60
Ala87
Ile71
Trp17
Asp88