Sequence:
download
PP61192sequence.fasta
>Ppa-LIT-1 MYFFQCKFVMRRRSTDFNITDPIGSQSSSGCSSGNSAESSEYPSIVPPSILPIIPHLNHIPSHNTIYHQQTISHPHLPIN QCHLVSQYIDPRAAQLAAQQHTAILLQHDMALVSHPTTSGQPIFKESSKRVPVQQNIPHQQLVREHVANQILSAPYAHGT FPPPVDTQPDRPIGYGAFGVVWSVTDPRSGKRLALKKMPNVFQNLASCKRVFREIKMLSSFNHDNVICLADIIQPPNPSF FQELFVYHIIHLHYGDRCVLTELMQSDLHKIIVSPQALTVDHVKVFVYQILRGLKYLHSANILHRDIKPGNLLVNSNCCL KICDFGLARIWDARERPTMTHEVVTQYYRAPELLMGARKYTDAIDVWSVGCIFAELMGRKILFQAAGPIEQLNMIIDVIG TPSHEDMILACEGARSHVLRQPIKRPNQRETLGRISNSMSEGAIDLLTKLLTFNPDKRMSVQEALDHDYLKDGRMRFHSC MCTCCHTLPSGQRQFTNDLEPFHNEPFDPRWERELARCSMFDLRDKLYNFVVDRHRNLQSEQNYVPVVINPHSAAYKNFT SLCMVPIPSPSQMNEYASSINPGQFPLSFLTQLCKLYWLAQVRQQSDTTGERRRLTRGNALDHDYLYDDRRRAMHRSTFN MSADHGLEEKYIELQKYRLMEEIGQGSYGVVKIAFSEEDNQLYALKLPYYDPLHMIYKEIAILKKLEHPNVVKLCDVLDE QNQNYLYLVFEYLERGSVMEVLPSPPMEEFEAWKYFREAFMGLQYLHHQKIIHRDIKPGNLLIGNDNSVKIADFGVSCEF AGIDAFLISTAGTPAFMAPETLYVRERPTPSIDKDMYKKLQIRLPKDQQAKVITGVPLPCFSGKSQDIWSLGATLYAFVY GEAPLWDVFVQGLHSKIKFNQIKYPARSKSGSAVSRECVRFMKRFLMRDGASRCELYEVEEDPWLTGKGKYPLSMDVKNI PIIRVTKQEIASSVRVFTSLGTLILIKNMGHRRRLMRNKEPIEDNEEEEFDGNGRLRFKRRDGITRRKSSSVKDPTYVPP DESRKERENSLKPDRPTELTLNNLSLFTRRSSSSTLTSSLDRR
view sequence (1083 aa)
>Ppa-LIT-1
MYFFQCKFVMRRRSTDFNITDPIGSQSSSGCSSGNSAESSEYPSIVPPSILPIIPHLNHIPSHNTIYHQQTISHPHLPIN
QCHLVSQYIDPRAAQLAAQQHTAILLQHDMALVSHPTTSGQPIFKESSKRVPVQQNIPHQQLVREHVANQILSAPYAHGT
FPPPVDTQPDRPIGYGAFGVVWSVTDPRSGKRLALKKMPNVFQNLASCKRVFREIKMLSSFNHDNVICLADIIQPPNPSF
FQELFVYHIIHLHYGDRCVLTELMQSDLHKIIVSPQALTVDHVKVFVYQILRGLKYLHSANILHRDIKPGNLLVNSNCCL
KICDFGLARIWDARERPTMTHEVVTQYYRAPELLMGARKYTDAIDVWSVGCIFAELMGRKILFQAAGPIEQLNMIIDVIG
TPSHEDMILACEGARSHVLRQPIKRPNQRETLGRISNSMSEGAIDLLTKLLTFNPDKRMSVQEALDHDYLKDGRMRFHSC
MCTCCHTLPSGQRQFTNDLEPFHNEPFDPRWERELARCSMFDLRDKLYNFVVDRHRNLQSEQNYVPVVINPHSAAYKNFT
SLCMVPIPSPSQMNEYASSINPGQFPLSFLTQLCKLYWLAQVRQQSDTTGERRRLTRGNALDHDYLYDDRRRAMHRSTFN
MSADHGLEEKYIELQKYRLMEEIGQGSYGVVKIAFSEEDNQLYALKLPYYDPLHMIYKEIAILKKLEHPNVVKLCDVLDE
QNQNYLYLVFEYLERGSVMEVLPSPPMEEFEAWKYFREAFMGLQYLHHQKIIHRDIKPGNLLIGNDNSVKIADFGVSCEF
AGIDAFLISTAGTPAFMAPETLYVRERPTPSIDKDMYKKLQIRLPKDQQAKVITGVPLPCFSGKSQDIWSLGATLYAFVY
GEAPLWDVFVQGLHSKIKFNQIKYPARSKSGSAVSRECVRFMKRFLMRDGASRCELYEVEEDPWLTGKGKYPLSMDVKNI
PIIRVTKQEIASSVRVFTSLGTLILIKNMGHRRRLMRNKEPIEDNEEEEFDGNGRLRFKRRDGITRRKSSSVKDPTYVPP
DESRKERENSLKPDRPTELTLNNLSLFTRRSSSSTLTSSLDRR
Estimated Isoelectric Point:
8.68885040283203
Estimated Molecular Weight:
124.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr46
Lys56
Gln53
Leu102
Gly51
Met32
Ser84
Tyr41
His40
Glu61
Arg76
Cys23
Phe47
Pro70
Val62
Asn47
Ala55
Ile70
Trp9
Asp58