Sequence:
download
PP61144sequence.fasta
>Ppa-UNC-13 MRMRREADRANALLAFSKSFKKVRRARSAFPRRKKRGRKRAKRRTKSLPNLKLCEPPAPAENGNAGIVRQRSSSLHSNRG RLRKEKRVDSSDGRKSFRSSAVALEVAAAKCNSRNGSATHLLPPPSPHLPPMCPVSPIPALAANGSANGEIQIPNGLALF KKKVQLLDVYDRRRLMQGRSASTQNQSSILDGDGRSAINAFYKSIDAMPNMNVARTKTSIPLVSELTMATKRAQAGLANN AKTTFADEELKAHVYRKTLQALLYPISCTTPHNFQTTNFQTPTWCYECEGLLWGLARQGLRCSECGVKVHEKCKDLISAD CLQRAAEKSSKHGEGDRTQNLIQVMRDRMKIQERNKPEIFETIRTIFSVDERTQQEALKQAKSSILEGSSKWSAKITLTG RKGKTADTNNPSGAESRVEREVLLCHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLE KRTDKSAVSGAIRLHISVEIKGEEKLAPYHVQYTCLHEHLFFSHCILVDGNDEVRLPDAKGEESWKVYFDDTGQEICDEF SMRYGVESIYQAMTHFACLCTRYMCPSVPAVLSTLLANINAYYAHTTATSAVSASDRFSASNFGKDRFVKLLDQLHNSLR IDLSMYRKYFPTNKPAKLQDLKSTVDLLTSITFFRMKVLELSSPPRASVVVQECAKACMETTYQLLFDSCCDTGGPREDS VKFWFDFLDYMIGAIEEDKGVYTLVLNQFPQELDVGKLSASTLWTLYKTDLKLALDDHAKTKKCSTPEYMNLYFKVKGFY FKYVVDIPPFNSCIPEFPTWFIPFVMDWLNENDEHSMEILRNAYNRDKSDNFPQTSEHTKFSNSVVDVFTQLNEALKLLK QMDCPNPEVYADMMKRFSKTLNKVLLAYADMVHKDFPRFAANEKLACILMNNVQQLRVQLEKIYENMGGAELDPQASDVL TKLQKKLNNVLDKLGREFAVYLEPNIKEQMIKLGNLLSKIKGQQLQKTQVAAEVDIVLEPLMDVLEATLQRFSQQCEKTV MKYLLKEMWKITVVSMEKIVVLPPLDNKALLKQLPNAKIGDMTKLMSTKINDVKGLSSVKDMMDIAREGSERSLSPKQCT VLDAALDAIKECFHAGGQGLKKSFFEKSEELQALKYALSLYTQTSEQLIRTFITGQKNQDLPSQEQPVGEISVQVDLFAH PGTGEQKVTVKILAANDLRWQTTSVFKPFVEVHLVGPHLADKKRKQATKTKSGNWAPKFNETFHFFLGNEGEPEHYELIF QVKDYCFAREDRIVGVGVLQLASIVEQGSCSMWVQLGSRLQIDDDGLILLRILSQRQADDVAKEFVK
view sequence (1347 aa)
>Ppa-UNC-13
MRMRREADRANALLAFSKSFKKVRRARSAFPRRKKRGRKRAKRRTKSLPNLKLCEPPAPAENGNAGIVRQRSSSLHSNRG
RLRKEKRVDSSDGRKSFRSSAVALEVAAAKCNSRNGSATHLLPPPSPHLPPMCPVSPIPALAANGSANGEIQIPNGLALF
KKKVQLLDVYDRRRLMQGRSASTQNQSSILDGDGRSAINAFYKSIDAMPNMNVARTKTSIPLVSELTMATKRAQAGLANN
AKTTFADEELKAHVYRKTLQALLYPISCTTPHNFQTTNFQTPTWCYECEGLLWGLARQGLRCSECGVKVHEKCKDLISAD
CLQRAAEKSSKHGEGDRTQNLIQVMRDRMKIQERNKPEIFETIRTIFSVDERTQQEALKQAKSSILEGSSKWSAKITLTG
RKGKTADTNNPSGAESRVEREVLLCHNSTDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTVIEVRTLSGEMDVWYNLE
KRTDKSAVSGAIRLHISVEIKGEEKLAPYHVQYTCLHEHLFFSHCILVDGNDEVRLPDAKGEESWKVYFDDTGQEICDEF
SMRYGVESIYQAMTHFACLCTRYMCPSVPAVLSTLLANINAYYAHTTATSAVSASDRFSASNFGKDRFVKLLDQLHNSLR
IDLSMYRKYFPTNKPAKLQDLKSTVDLLTSITFFRMKVLELSSPPRASVVVQECAKACMETTYQLLFDSCCDTGGPREDS
VKFWFDFLDYMIGAIEEDKGVYTLVLNQFPQELDVGKLSASTLWTLYKTDLKLALDDHAKTKKCSTPEYMNLYFKVKGFY
FKYVVDIPPFNSCIPEFPTWFIPFVMDWLNENDEHSMEILRNAYNRDKSDNFPQTSEHTKFSNSVVDVFTQLNEALKLLK
QMDCPNPEVYADMMKRFSKTLNKVLLAYADMVHKDFPRFAANEKLACILMNNVQQLRVQLEKIYENMGGAELDPQASDVL
TKLQKKLNNVLDKLGREFAVYLEPNIKEQMIKLGNLLSKIKGQQLQKTQVAAEVDIVLEPLMDVLEATLQRFSQQCEKTV
MKYLLKEMWKITVVSMEKIVVLPPLDNKALLKQLPNAKIGDMTKLMSTKINDVKGLSSVKDMMDIAREGSERSLSPKQCT
VLDAALDAIKECFHAGGQGLKKSFFEKSEELQALKYALSLYTQTSEQLIRTFITGQKNQDLPSQEQPVGEISVQVDLFAH
PGTGEQKVTVKILAANDLRWQTTSVFKPFVEVHLVGPHLADKKRKQATKTKSGNWAPKFNETFHFFLGNEGEPEHYELIF
QVKDYCFAREDRIVGVGVLQLASIVEQGSCSMWVQLGSRLQIDDDGLILLRILSQRQADDVAKEFVK
Estimated Isoelectric Point:
8.94359588623047
Estimated Molecular Weight:
152.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr74
Lys114
Gln66
Leu139
Gly62
Met36
Ser99
Tyr34
His26
Glu86
Arg77
Cys30
Phe57
Pro56
Val86
Asn59
Ala98
Ile56
Trp14
Asp78