Sequence:
download
PP60087sequence.fasta
>Ppa-RHEB-1 MTKRNSLTEEATEAVEGIIMNPSPQLSSRNTDNHKGMRYNRKIAIMGYPCVGKSSITLRFINGNFPEAYDTTIEDRHDKT YSWKGRDYALRITDTAGQQEFTIFPRSCSVDVDGFILVYAIDDRKSFEIIQTIHDKIVECVGDRNVPVVVVGNKLDLQYA CRAVTREEGEALAKQWNASFVEISARDLEKKQLISNQPVVQEVPAEPVKEEGVFRKILLSCFPSGSVHQDRNQPAAKKST DKVPNEVNAIFEQAILAIEVAKGNMTPGGKPTTGPGSRESRCSMM
view sequence (285 aa)
>Ppa-RHEB-1
MTKRNSLTEEATEAVEGIIMNPSPQLSSRNTDNHKGMRYNRKIAIMGYPCVGKSSITLRFINGNFPEAYDTTIEDRHDKT
YSWKGRDYALRITDTAGQQEFTIFPRSCSVDVDGFILVYAIDDRKSFEIIQTIHDKIVECVGDRNVPVVVVGNKLDLQYA
CRAVTREEGEALAKQWNASFVEISARDLEKKQLISNQPVVQEVPAEPVKEEGVFRKILLSCFPSGSVHQDRNQPAAKKST
DKVPNEVNAIFEQAILAIEVAKGNMTPGGKPTTGPGSRESRCSMM
Estimated Isoelectric Point:
6.46802520751953
Estimated Molecular Weight:
31.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr17
Lys19
Gln12
Leu13
Gly18
Met7
Ser20
Tyr7
His4
Glu22
Arg18
Cys6
Phe10
Pro15
Val23
Asn15
Ala20
Ile21
Trp2
Asp16