Sequence:
download
PP56196sequence.fasta
>Ppa-GLD-2 MDRVESLEGVNEMDGSMAISVKAFHNGIPVPPIHTEMRDMQCLSSSTSSSSISNLHRPSIDTPPLIPSLGGPLTSIPPPS LTTTVSTSTHPPTVSSALPSTMVAHPQRSQETLYRACGSSSRHQYHHHPSHPSLSHPHSNHLSTTTTSMLHPQQRTLIQH PQNGVVFHLQGNQSISGYISLSLFIRMTTMVPPSGVNVMGMGCHRLDSMDSYHSCPSPSTSMRSSCFSSSSEMETEDSLP SSSSSLRVPLGEGEPPPSIGYYGGRERRGRCVVVEMTDEELEYVERAHENSRLIEIYGDIAERFVAPPPYIFWPAEVRLP WTLPTRMKRSLLMKDRKMKRWLMEQSDEGARMGLNGGNIGGPRKEESLSSSRSPFLSAPHPTAWNTAAPVATGGVGESVG SVPPRAPPSGFVDEGGRFTISEMDYLSEEIWHYHNTMTQTESTLSRKLHLRDMLYYAICPVFPMCGLYVVGSSLNGFGNN SSDMDLCLMITNKDLDQKSDAVMVLNMILDQLVNVEWVAHQQLILAKVPILRIQFTAPFGDITVDLNANNSVAIKNTHLL CYYSSFDWRVRPLVTIVKEWAKKKGINDANRSSFTSYSLVLMVIHYLQCGVDQPVLPSLQSMYTRRFSRTADVRSLNVSI PLAHPPDDWSFNDTSSLGELLIGFLEYFATKFDYNANAISVRMGKKLDRTAVVRSRAQYGNQMNNWRSQWRCVCIEEPFT YSNTAHSVYDEMVFMKIKEAFKDAYNLLESTRDLSKLMDCSPIAVPILPHGNGAVVYMGGSTHADTSAVASSSSSSLSNP HSGHASSASSSCGDDEVKEGIPPIPPIARSIISPSTCSTPIKKEIPPSSSNLNPNRSSQRSETIPSPVVSTNQ
view sequence (873 aa)
>Ppa-GLD-2
MDRVESLEGVNEMDGSMAISVKAFHNGIPVPPIHTEMRDMQCLSSSTSSSSISNLHRPSIDTPPLIPSLGGPLTSIPPPS
LTTTVSTSTHPPTVSSALPSTMVAHPQRSQETLYRACGSSSRHQYHHHPSHPSLSHPHSNHLSTTTTSMLHPQQRTLIQH
PQNGVVFHLQGNQSISGYISLSLFIRMTTMVPPSGVNVMGMGCHRLDSMDSYHSCPSPSTSMRSSCFSSSSEMETEDSLP
SSSSSLRVPLGEGEPPPSIGYYGGRERRGRCVVVEMTDEELEYVERAHENSRLIEIYGDIAERFVAPPPYIFWPAEVRLP
WTLPTRMKRSLLMKDRKMKRWLMEQSDEGARMGLNGGNIGGPRKEESLSSSRSPFLSAPHPTAWNTAAPVATGGVGESVG
SVPPRAPPSGFVDEGGRFTISEMDYLSEEIWHYHNTMTQTESTLSRKLHLRDMLYYAICPVFPMCGLYVVGSSLNGFGNN
SSDMDLCLMITNKDLDQKSDAVMVLNMILDQLVNVEWVAHQQLILAKVPILRIQFTAPFGDITVDLNANNSVAIKNTHLL
CYYSSFDWRVRPLVTIVKEWAKKKGINDANRSSFTSYSLVLMVIHYLQCGVDQPVLPSLQSMYTRRFSRTADVRSLNVSI
PLAHPPDDWSFNDTSSLGELLIGFLEYFATKFDYNANAISVRMGKKLDRTAVVRSRAQYGNQMNNWRSQWRCVCIEEPFT
YSNTAHSVYDEMVFMKIKEAFKDAYNLLESTRDLSKLMDCSPIAVPILPHGNGAVVYMGGSTHADTSAVASSSSSSLSNP
HSGHASSASSSCGDDEVKEGIPPIPPIARSIISPSTCSTPIKKEIPPSSSNLNPNRSSQRSETIPSPVVSTNQ
Estimated Isoelectric Point:
6.47550201416016
Estimated Molecular Weight:
96.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr52
Lys25
Gln25
Leu69
Gly50
Met36
Ser125
Tyr26
His32
Glu43
Arg48
Cys16
Phe23
Pro70
Val57
Asn39
Ala43
Ile45
Trp11
Asp38