Sequence:
download
PP56152sequence.fasta
>Ppa-RAD-54.L FQRMFKPGSEAAKRRASLSSPVPVPQFRSPLAKVESGLRSKKPKLNQALASLATPREEIMNPLRFELKLEDDRTSHEELI FKLLNQPFRIPIPGYSLSGRPLGARSGGRKCSLFDPYAEGAVVLYAPPQAATAHEEMMMAKSKDVQVHVVVDPIVGRVLR PHQKEGVRFMYDCVTGRAIDAFNGCIMADEMGLGKTLQCISLMWTLLRQSPKGEPEISKAIIVCPSSLVKNWDDEIRKWL GERVGTLRIDSGGGSNINASLTTWIMDTRKRVAAPVLILSYECFRMYAEVLHKNEVGLIICDEGHRLKNSDNLTYKALSA VKCVRRVLISGTPIQNDLLEYLSLLNFVNPGLLGTTAEFKKKFENVILRGRDAEATDEQQKKGNEATTEMAAIVSKCVIR RTSTLLTKYLPVKYEHVVCCKPQSLQAEIYARLMELEKKSRSSEEKGVNSALAFITLLKKLCNHPTLLREELSKDNSRFA SVASMLDGIGKAFEVSLSGKMKVLDCLLAVTKKTTTDRFVLVSNYTQTIDQFIELCRVRGYGFVRLDGSMTTKQRAKIVK EFNAPESAIFCFLLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKNCFIYRFLTTGSIEEKIFQRQTH KKALSSCVVDAEEAERHFSSEQLRDLFVHVKETTSDTHDKLKCKRCVNGLESVDPPLNADCSSDLSLWMHSQRDVRKVAD SVLRTVFSTGAVSFIFHQRSHDATAKEEKKKEEKENEEEEEKECVEKEDDEDYEPYRLRAPGRSLYSDMTTQSKRKTATK DSKKSVKRKSATPSKNKKERRNRIAETKDPNRRWLKEIVANFLNPDSSKIKYDVDTVFKLLDQVLVDMTIQPTLLEFEAP TYVCGDIHGQITDLRRILHICGYPTTKRFLFLGDYVDRGLHSLEVICTLFALRLLFKNNVYLLRGNHELAHINKTYGFQE EVKKKFPTEPIKSGEVYRKFNEVFGFLPLAAVVSNKILCMHGGLSPALHSLDDIRKLERPITTPKGLAQDILWADPQVYP EDPEVDAEVDPEVTEGVCGFKNNSMRACSFNFGEKDVEERLKKMGLSKMIRAHQVVPKGWDTFANGRVITVFSASRYQED MYNYAAIIDIQKNLRMEIMQIKPADYEDVMNAYQKDEVTKDTPQTDSKTQDEKSFRVGMVKETALYDLLEVGPTATDGEL KKAYRKLALKYHPDKNPDDPEKFKHISQAYEILSDSQKRQIYDQGGMEAIQGGGGGGEGFHDPMDIFSMFFGGGRGGGSR RARTVRPTVHQMRVSLEQLYKGCTRKLKISRVCLCKPCEGRGGAVGAEKQCGECDGHGVVIKMQRIGPGMVTQMQSRCSA CNGEGKSIAAKDRCKSCNGKKKAQEEQIIEVKIEPGMHDGEKIVFEGKGNEEPGLPPGDIIIVLDEQKHGTFARQGANLI MEEKIDLVEALCGFTRVITTLDDKKIYYSSLPGEVIDHGDVKVIQARGMPHHRNPSDKGDILIQFRVQFPAQLDDNSRRV LSQLLPEKTTVMVDDDVETYELDKVGPSNHSRSRGGHGGGHAHGFEDGNGVRCQQQ
view sequence (1576 aa)
>Ppa-RAD-54.L
FQRMFKPGSEAAKRRASLSSPVPVPQFRSPLAKVESGLRSKKPKLNQALASLATPREEIMNPLRFELKLEDDRTSHEELI
FKLLNQPFRIPIPGYSLSGRPLGARSGGRKCSLFDPYAEGAVVLYAPPQAATAHEEMMMAKSKDVQVHVVVDPIVGRVLR
PHQKEGVRFMYDCVTGRAIDAFNGCIMADEMGLGKTLQCISLMWTLLRQSPKGEPEISKAIIVCPSSLVKNWDDEIRKWL
GERVGTLRIDSGGGSNINASLTTWIMDTRKRVAAPVLILSYECFRMYAEVLHKNEVGLIICDEGHRLKNSDNLTYKALSA
VKCVRRVLISGTPIQNDLLEYLSLLNFVNPGLLGTTAEFKKKFENVILRGRDAEATDEQQKKGNEATTEMAAIVSKCVIR
RTSTLLTKYLPVKYEHVVCCKPQSLQAEIYARLMELEKKSRSSEEKGVNSALAFITLLKKLCNHPTLLREELSKDNSRFA
SVASMLDGIGKAFEVSLSGKMKVLDCLLAVTKKTTTDRFVLVSNYTQTIDQFIELCRVRGYGFVRLDGSMTTKQRAKIVK
EFNAPESAIFCFLLSSKAGGCGLNLIGANRLVMFDPDWNPANDDQAMARVWRDGQKKNCFIYRFLTTGSIEEKIFQRQTH
KKALSSCVVDAEEAERHFSSEQLRDLFVHVKETTSDTHDKLKCKRCVNGLESVDPPLNADCSSDLSLWMHSQRDVRKVAD
SVLRTVFSTGAVSFIFHQRSHDATAKEEKKKEEKENEEEEEKECVEKEDDEDYEPYRLRAPGRSLYSDMTTQSKRKTATK
DSKKSVKRKSATPSKNKKERRNRIAETKDPNRRWLKEIVANFLNPDSSKIKYDVDTVFKLLDQVLVDMTIQPTLLEFEAP
TYVCGDIHGQITDLRRILHICGYPTTKRFLFLGDYVDRGLHSLEVICTLFALRLLFKNNVYLLRGNHELAHINKTYGFQE
EVKKKFPTEPIKSGEVYRKFNEVFGFLPLAAVVSNKILCMHGGLSPALHSLDDIRKLERPITTPKGLAQDILWADPQVYP
EDPEVDAEVDPEVTEGVCGFKNNSMRACSFNFGEKDVEERLKKMGLSKMIRAHQVVPKGWDTFANGRVITVFSASRYQED
MYNYAAIIDIQKNLRMEIMQIKPADYEDVMNAYQKDEVTKDTPQTDSKTQDEKSFRVGMVKETALYDLLEVGPTATDGEL
KKAYRKLALKYHPDKNPDDPEKFKHISQAYEILSDSQKRQIYDQGGMEAIQGGGGGGEGFHDPMDIFSMFFGGGRGGGSR
RARTVRPTVHQMRVSLEQLYKGCTRKLKISRVCLCKPCEGRGGAVGAEKQCGECDGHGVVIKMQRIGPGMVTQMQSRCSA
CNGEGKSIAAKDRCKSCNGKKKAQEEQIIEVKIEPGMHDGEKIVFEGKGNEEPGLPPGDIIIVLDEQKHGTFARQGANLI
MEEKIDLVEALCGFTRVITTLDDKKIYYSSLPGEVIDHGDVKVIQARGMPHHRNPSDKGDILIQFRVQFPAQLDDNSRRV
LSQLLPEKTTVMVDDDVETYELDKVGPSNHSRSRGGHGGGHAHGFEDGNGVRCQQQ
Estimated Isoelectric Point:
8.57466888427734
Estimated Molecular Weight:
177.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr78
Lys133
Gln61
Leu136
Gly114
Met41
Ser100
Tyr39
His37
Glu118
Arg101
Cys40
Phe60
Pro70
Val108
Asn55
Ala96
Ile81
Trp10
Asp98