Sequence:
download
PP52797sequence.fasta
>Ppa-SUP-12 MKRRRGARAIFSRFVHCVCVGRVLINVAHSRRNRMHSLYGLGGASGGTSVAELQAAAAAAALASTTSDMNPVTGSKDTTL TKIFVGGLPYHTSDKTLHEYFEQFGEIEEAVVITDRQTQKSRGYGFVTMKDRPAAERACKDPNPIIDGRKANVNLAYLGA KPRGNLQLGGMTALTNNVQLPLQTQLQALFPQRLGMPQLFMQPQNAFMNPLLGLGGMQAHGQLMDYSQALAAAMAAQGGA GGAAAAQAAALNQAGAAALFHQSGVPTSAAGSYDHYAAAAAAYNPYAAFQGGFPLQSAQLAAASAAAAAAEHQRV
view sequence (315 aa)
>Ppa-SUP-12
MKRRRGARAIFSRFVHCVCVGRVLINVAHSRRNRMHSLYGLGGASGGTSVAELQAAAAAAALASTTSDMNPVTGSKDTTL
TKIFVGGLPYHTSDKTLHEYFEQFGEIEEAVVITDRQTQKSRGYGFVTMKDRPAAERACKDPNPIIDGRKANVNLAYLGA
KPRGNLQLGGMTALTNNVQLPLQTQLQALFPQRLGMPQLFMQPQNAFMNPLLGLGGMQAHGQLMDYSQALAAAMAAQGGA
GGAAAAQAAALNQAGAAALFHQSGVPTSAAGSYDHYAAAAAAYNPYAAFQGGFPLQSAQLAAASAAAAAAEHQRV
Estimated Isoelectric Point:
9.61266326904297
Estimated Molecular Weight:
32.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys9
Gln24
Leu28
Gly32
Met11
Ser16
Tyr10
His9
Glu8
Arg17
Cys3
Phe12
Pro14
Val15
Asn13
Ala62
Ile7
Asp9