Sequence:
download
PP51711sequence.fasta
>Ppa-MOG-4 MMQMSIETWVNDELHTLVGMSDRNTANFIISLARKAMDTTDLVQKLADSGAIDVNTKVERFASQLMSRIPRSAPKAERQR GPSAAELAEQQMRKMNAAAKMIDYGSEDKTKKKGAHARKRDENYDDYSAPISKSDKKSKKMKKEADSGESDIDEMNRALD DDIKERDELAERLKNKDKSNTRNVVEVGRKKAENKDKIGMDMSKLRDESRKAYLAKRHLEKIEDLELQVLDDEQLFNDEE LTERERRDKDLRKKQLEYAKSYLKAEDHLKVKRYHVPDASVKITDKYVEEDDHRPGGDGAKWEEERFKASLLKFGAGDAA TRQQEFDLLLDEKIDFIQALQMPGTSEQQKELSAAEKKKMTLDETRKSLPVYAFRDAFIEAVREHQVLIIEGETGSGKTT QLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVAEEVGTKIGSTVGYSIRFEDCTSEKTLIKYMTDGMLLREFLNEPD LSSYSVMMIDEAHERTLHTDILFGLVKDIARFRKDMKLLISSATLDAEKFSTFFDDAPIFRIPGRRFPVDIYYTKAPEAD YLDAAMVSVLQIHLTQPLPGDILVFLTGQEEIETVMESLIERTKQLAGKVKELIILPIYANLPSDMQAKIFEPTPPNARK VILATNIAETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYQHELED QPIPEIQRVNLGNVVLMLKSLGIHDLVHFDFLDAPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMII ASEKYACSEEIVTIASMLSVNAAVFYRPKAMVIHADSARKGFWSPAGDHLSLMNVYNKWKETDFNMQWCMENFVQHRTMK KARDIRDQLMALLERVEIEPKSSDDSIAIRKAITAGYFYNCSKLDNSGHYKTVKHKHTVQPHPNSCLFEELPRWVVYYEL VFTSKEFMREMITIEPLWLLEVAPHYYKQRELEDATNKKMPKQKGKSKAELE
view sequence (1012 aa)
>Ppa-MOG-4
MMQMSIETWVNDELHTLVGMSDRNTANFIISLARKAMDTTDLVQKLADSGAIDVNTKVERFASQLMSRIPRSAPKAERQR
GPSAAELAEQQMRKMNAAAKMIDYGSEDKTKKKGAHARKRDENYDDYSAPISKSDKKSKKMKKEADSGESDIDEMNRALD
DDIKERDELAERLKNKDKSNTRNVVEVGRKKAENKDKIGMDMSKLRDESRKAYLAKRHLEKIEDLELQVLDDEQLFNDEE
LTERERRDKDLRKKQLEYAKSYLKAEDHLKVKRYHVPDASVKITDKYVEEDDHRPGGDGAKWEEERFKASLLKFGAGDAA
TRQQEFDLLLDEKIDFIQALQMPGTSEQQKELSAAEKKKMTLDETRKSLPVYAFRDAFIEAVREHQVLIIEGETGSGKTT
QLPQYLYEAGFCEGGKRIGCTQPRRVAAMSVAARVAEEVGTKIGSTVGYSIRFEDCTSEKTLIKYMTDGMLLREFLNEPD
LSSYSVMMIDEAHERTLHTDILFGLVKDIARFRKDMKLLISSATLDAEKFSTFFDDAPIFRIPGRRFPVDIYYTKAPEAD
YLDAAMVSVLQIHLTQPLPGDILVFLTGQEEIETVMESLIERTKQLAGKVKELIILPIYANLPSDMQAKIFEPTPPNARK
VILATNIAETSVTIDGICYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFRLYTAWAYQHELED
QPIPEIQRVNLGNVVLMLKSLGIHDLVHFDFLDAPPQETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMII
ASEKYACSEEIVTIASMLSVNAAVFYRPKAMVIHADSARKGFWSPAGDHLSLMNVYNKWKETDFNMQWCMENFVQHRTMK
KARDIRDQLMALLERVEIEPKSSDDSIAIRKAITAGYFYNCSKLDNSGHYKTVKHKHTVQPHPNSCLFEELPRWVVYYEL
VFTSKEFMREMITIEPLWLLEVAPHYYKQRELEDATNKKMPKQKGKSKAELE
Estimated Isoelectric Point:
6.25237274169922
Estimated Molecular Weight:
115.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys90
Gln37
Leu88
Gly47
Met38
Ser60
Tyr32
His24
Glu89
Arg62
Cys11
Phe35
Pro39
Val53
Asn30
Ala88
Ile58
Trp8
Asp73