Sequence:
download
OVP14728sequence.fasta
>Ovo-UNC-43, isoform b MVVIPQATNVMNSTSTNFSDNYEVKEELGKGAFSVVRRCVQKRTGLEFAAKIINTKKLSTRDFQKLEREARICRKLQHPN IVRLHDNIQEEAFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHLNNVVHRDLKPENLLLASKAKGAA VKLADFGLAIEVQGDAEAWFGFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYD YPSPEWDTVTPEAKNLIDNMLTVNPKKRITAEQALKVPWICNRERVASVIHRQDTVDCLKKFNARRKLKGAILTTMIATR NLSSRNLLNKKEAPPSTIKESSESSQTIDDQDSDKVQKQEIVRVTQQLLDAISCKDYESYSRLCDPSMTCFEPEALGNLI EGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYIRLTQFIDKNGDARSRQAQETRVWHKRNGRGWVCVHVH RTGAPSSVNTADCHF
view sequence (495 aa)
>Ovo-UNC-43, isoform b
MVVIPQATNVMNSTSTNFSDNYEVKEELGKGAFSVVRRCVQKRTGLEFAAKIINTKKLSTRDFQKLEREARICRKLQHPN
IVRLHDNIQEEAFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHLNNVVHRDLKPENLLLASKAKGAA
VKLADFGLAIEVQGDAEAWFGFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYD
YPSPEWDTVTPEAKNLIDNMLTVNPKKRITAEQALKVPWICNRERVASVIHRQDTVDCLKKFNARRKLKGAILTTMIATR
NLSSRNLLNKKEAPPSTIKESSESSQTIDDQDSDKVQKQEIVRVTQQLLDAISCKDYESYSRLCDPSMTCFEPEALGNLI
EGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYIRLTQFIDKNGDARSRQAQETRVWHKRNGRGWVCVHVH
RTGAPSSVNTADCHF
Estimated Isoelectric Point:
7.21175384521484
Estimated Molecular Weight:
56.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys34
Gln21
Leu41
Gly26
Met7
Ser28
Tyr15
His15
Glu32
Arg29
Cys13
Phe19
Pro21
Val34
Asn26
Ala39
Ile30
Trp7
Asp31