Sequence:
download
OVP14723sequence.fasta
>Ovo-DAF-21, isoform b MDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVASKHNDDDCYQWESSAGGSFI IRQVNDPELTRGTKITLYIKEDQTDYLEERRIKEIVKKHSQFIGYPIKLTVEKERDKEVSDDEAEDEKKDESKEKQEGEI EDVGEDEDEDKKEKDKKKKKKIKEKYHEDEELNKTKPIWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHFSVEGQLEFR ALLFVPQRAPFDLFENKKTKNAIKLYVRRVFIMENCDELMPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLVK KCLELFDEIAEDKDNFKKFYEQFSKNIKLGIHEDSTNRKKLSEFLRFYTSASSEEMTSLKDYVSRMKENQKQIYFITGES REAVASSAFVERVKRRGFEVVYMTDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFEEDKVKFENLCKVMKDI LEKKVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVVKALRERVEADKNDKT VKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDITEDEEEEVVASVSGEKDECVPNLVGAEEDASRMEEVD
view sequence (637 aa)
>Ovo-DAF-21, isoform b
MDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVASKHNDDDCYQWESSAGGSFI
IRQVNDPELTRGTKITLYIKEDQTDYLEERRIKEIVKKHSQFIGYPIKLTVEKERDKEVSDDEAEDEKKDESKEKQEGEI
EDVGEDEDEDKKEKDKKKKKKIKEKYHEDEELNKTKPIWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHFSVEGQLEFR
ALLFVPQRAPFDLFENKKTKNAIKLYVRRVFIMENCDELMPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLVK
KCLELFDEIAEDKDNFKKFYEQFSKNIKLGIHEDSTNRKKLSEFLRFYTSASSEEMTSLKDYVSRMKENQKQIYFITGES
REAVASSAFVERVKRRGFEVVYMTDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFEEDKVKFENLCKVMKDI
LEKKVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVVKALRERVEADKNDKT
VKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDITEDEEEEVVASVSGEKDECVPNLVGAEEDASRMEEVD
Estimated Isoelectric Point:
5.05191802978516
Estimated Molecular Weight:
73.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr23
Lys76
Gln18
Leu49
Gly27
Met17
Ser45
Tyr20
His9
Glu82
Arg27
Cys8
Phe27
Pro14
Val48
Asn24
Ala34
Ile35
Trp4
Asp50