Sequence:
download
OVP14715sequence.fasta
>Ovo-UNC-43, isoform d MFYIFVIVVESLIQLWPLLLFMFTSIAVCHLAAKYTKNISGSTITATLTTTYALSASSSTINNGELGKRSIEEPYCVPAG YPYFEFIHSPVTVINTSVGRNLLNKKEAPPSTIKESSESSQTIDDQDSDKVQKQEIVRVTQQLLDAISCKDYESYSRLCD PSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYIRLTQFIDKNGDARSRQAQETRV WHKRNGRGWVCVHVHRTGAPSSVNTADCHF
view sequence (270 aa)
>Ovo-UNC-43, isoform d
MFYIFVIVVESLIQLWPLLLFMFTSIAVCHLAAKYTKNISGSTITATLTTTYALSASSSTINNGELGKRSIEEPYCVPAG
YPYFEFIHSPVTVINTSVGRNLLNKKEAPPSTIKESSESSQTIDDQDSDKVQKQEIVRVTQQLLDAISCKDYESYSRLCD
PSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYIRLTQFIDKNGDARSRQAQETRV
WHKRNGRGWVCVHVHRTGAPSSVNTADCHF
Estimated Isoelectric Point:
6.30171966552734
Estimated Molecular Weight:
30.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys13
Gln10
Leu20
Gly15
Met5
Ser25
Tyr10
His9
Glu15
Arg12
Cys8
Phe12
Pro12
Val17
Asn14
Ala16
Ile19
Trp3
Asp13