Sequence:
download
OVP14691sequence.fasta
>Ovo-UNC-43, isoform a MVVIPQATNVMNSTSTNFSDNYEVKEELGKGAFSVVRRCVQKRTGLEFAAKIINTKKLSTRDFQKLEREARICRKLQHPN IVRLHDNIQEEAFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHLNNVVHRDLKPENLLLASKAKGAA VKLADFGLAIEVQGDAEAWFGFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYD YPSPEWDTVTPEAKNLIDNMLTVNPKKRITAEQALKVPWICNRERVASVIHRQDTVDCLKKFNARRKLKGAILTTMIATR NLSSRNLLNKKEAPPSTIKESSESSQTIDDQDSDKAGKTLSHENTVVRVDTTLLKQQRRAAGISSNMGSPLPVQKQEIVR VTQQLLDAISCKDYESYSRLCDPSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYI RLTQFIDKNGDARSRQAQETRVWHKRNGRGWVCVHVHRTGAPSSVNTADCHF
view sequence (532 aa)
>Ovo-UNC-43, isoform a
MVVIPQATNVMNSTSTNFSDNYEVKEELGKGAFSVVRRCVQKRTGLEFAAKIINTKKLSTRDFQKLEREARICRKLQHPN
IVRLHDNIQEEAFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHLNNVVHRDLKPENLLLASKAKGAA
VKLADFGLAIEVQGDAEAWFGFAGTPGYLSPEVLKKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYD
YPSPEWDTVTPEAKNLIDNMLTVNPKKRITAEQALKVPWICNRERVASVIHRQDTVDCLKKFNARRKLKGAILTTMIATR
NLSSRNLLNKKEAPPSTIKESSESSQTIDDQDSDKAGKTLSHENTVVRVDTTLLKQQRRAAGISSNMGSPLPVQKQEIVR
VTQQLLDAISCKDYESYSRLCDPSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYI
RLTQFIDKNGDARSRQAQETRVWHKRNGRGWVCVHVHRTGAPSSVNTADCHF
Estimated Isoelectric Point:
8.12264251708984
Estimated Molecular Weight:
59.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr31
Lys36
Gln23
Leu45
Gly29
Met8
Ser32
Tyr15
His16
Glu33
Arg32
Cys13
Phe19
Pro23
Val37
Asn28
Ala42
Ile31
Trp7
Asp32