Sequence:
download
OVP14680sequence.fasta
>Ovo-DAF-21, isoform c MTDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFEEDKVKFENLCKVMKDILEKKVEKVAVSNRLVSSPCCIV TSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVVKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLED PQLHASRIYRMIKLGLDITEDEEEEVVASVSGEKDECVPNLVGAEEDASRMEEVD
view sequence (215 aa)
>Ovo-DAF-21, isoform c
MTDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFEEDKVKFENLCKVMKDILEKKVEKVAVSNRLVSSPCCIV
TSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVVKALRERVEADKNDKTVKDLVVLLFETALLSSGFSLED
PQLHASRIYRMIKLGLDITEDEEEEVVASVSGEKDECVPNLVGAEEDASRMEEVD
Estimated Isoelectric Point:
4.74526214599609
Estimated Molecular Weight:
24.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys23
Gln4
Leu20
Gly8
Met8
Ser17
Tyr5
His3
Glu31
Arg8
Cys5
Phe4
Pro6
Val22
Asn6
Ala13
Ile8
Trp1
Asp16