Sequence:
download
OVP14673sequence.fasta
>Ovo-UNC-43, isoform c MFYIFVIVVESLIQLWPLLLFMFTSIAVCHLAAKYTKNISGSTITATLTTTYALSASSSTINNGELGKRSIEEPYCVPAG YPYFEFIHSPVTVINTSVGRNLLNKKEAPPSTIKESSESSQTIDDQDSDKAGKTLSHENTVVRVDTTLLKQQRRAAGISS NMGSPLPVQKQEIVRVTQQLLDAISCKDYESYSRLCDPSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNP NVHLMGDEGACIAYIRLTQFIDKNGDARSRQAQETRVWHKRNGRGWVCVHVHRTGAPSSVNTADCHF
view sequence (307 aa)
>Ovo-UNC-43, isoform c
MFYIFVIVVESLIQLWPLLLFMFTSIAVCHLAAKYTKNISGSTITATLTTTYALSASSSTINNGELGKRSIEEPYCVPAG
YPYFEFIHSPVTVINTSVGRNLLNKKEAPPSTIKESSESSQTIDDQDSDKAGKTLSHENTVVRVDTTLLKQQRRAAGISS
NMGSPLPVQKQEIVRVTQQLLDAISCKDYESYSRLCDPSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNP
NVHLMGDEGACIAYIRLTQFIDKNGDARSRQAQETRVWHKRNGRGWVCVHVHRTGAPSSVNTADCHF
Estimated Isoelectric Point:
7.12662506103516
Estimated Molecular Weight:
34.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys15
Gln12
Leu24
Gly18
Met6
Ser29
Tyr10
His10
Glu16
Arg15
Cys8
Phe12
Pro14
Val20
Asn16
Ala19
Ile20
Trp3
Asp14