Sequence:
download
OVP14659sequence.fasta
>Ovo-UNC-43, isoform e MRNCATIMNAQHLFPRKIDYFAGKTLSHENTVVRVDTTLLKQQRRAAGISSNMGSPLPVQKQEIVRVTQQLLDAISCKDY ESYSRLCDPSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYIRLTQFIDKNGDARS RQAQETRVWHKRNGRGWVCVHVHRTGAPSSVNTADCHF
view sequence (198 aa)
>Ovo-UNC-43, isoform e
MRNCATIMNAQHLFPRKIDYFAGKTLSHENTVVRVDTTLLKQQRRAAGISSNMGSPLPVQKQEIVRVTQQLLDAISCKDY
ESYSRLCDPSMTCFEPEALGNLIEGMDFHKFYFDNNSGTRGPKIHTTLLNPNVHLMGDEGACIAYIRLTQFIDKNGDARS
RQAQETRVWHKRNGRGWVCVHVHRTGAPSSVNTADCHF
Estimated Isoelectric Point:
8.88111114501953
Estimated Molecular Weight:
22.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys9
Gln10
Leu14
Gly13
Met6
Ser12
Tyr5
His9
Glu8
Arg15
Cys7
Phe8
Pro8
Val12
Asn12
Ala13
Ile10
Trp2
Asp11