Sequence:
download
OVP14577sequence.fasta
>Ovo-RAD-54 MRRSLAPSTVSGTSSSPGIKSCVLHSDEKKLRERKKHKLNTTENNENPDRDEYKSPYRKILITAMDDLMQKEQGFHEEMI SKLLSRPFKMPIPDYTSPGRARPLGLRHSSVRCALFDPYTEGALVLFTPPELSAHDALKIDATNKQVHVVVDPMLSAVLR PHQREGVKFMYDCVTGVRIPSAHGCIMADEMGLGKTLQCITLMWTLLRQGPDAKPTLNKTVIVCPSSLVKNWDKEIRKWL GGRVNALPVDSGGKDEIDRNLEKFMCQMGVRCPTPVLIISYETFRLHASILLQKEIGLIICDEGHRLKNSDNQTYQALFG LKCVRRVLISGTPIQNDLLEYYSLINFVNPGLLGTASEFKRRFENIILRGRDADATDAQRERGDAALIEMSSIVNKCIIR RTSALLTKYLPVKYELILCCKLTKLQEKLYKQLISAFSSNGKQKVTEGKCDKITGTALSFITNLKKLCNHPQLILDKCQK KEEGFEGCLELFPREFSGKFEPAFSGKMKVLDYLLAITRATTNDKFVLVSNYTQTIDAFVELCQLRRYPYIRLDGTCTIK QRAKLVEKFNDPESVEYVFLLSSKAGGCGLNLIGANRLIMFDPDWNPANDDQAMARVWRDGQKKNCFIYRLLATGSIEEK MFQRQAHKKALSSCVVDEASDVARHFSKDQLRDLFDLKTDIASDTHNSLKCSRCVNGIEYREPQECADTNSDLSEWYHVQ KDVRKVPDKVLKRIFECGTITFVFHQKSHDVKSEIIKEEDEIKENDLLNEEGEG
view sequence (774 aa)
>Ovo-RAD-54
MRRSLAPSTVSGTSSSPGIKSCVLHSDEKKLRERKKHKLNTTENNENPDRDEYKSPYRKILITAMDDLMQKEQGFHEEMI
SKLLSRPFKMPIPDYTSPGRARPLGLRHSSVRCALFDPYTEGALVLFTPPELSAHDALKIDATNKQVHVVVDPMLSAVLR
PHQREGVKFMYDCVTGVRIPSAHGCIMADEMGLGKTLQCITLMWTLLRQGPDAKPTLNKTVIVCPSSLVKNWDKEIRKWL
GGRVNALPVDSGGKDEIDRNLEKFMCQMGVRCPTPVLIISYETFRLHASILLQKEIGLIICDEGHRLKNSDNQTYQALFG
LKCVRRVLISGTPIQNDLLEYYSLINFVNPGLLGTASEFKRRFENIILRGRDADATDAQRERGDAALIEMSSIVNKCIIR
RTSALLTKYLPVKYELILCCKLTKLQEKLYKQLISAFSSNGKQKVTEGKCDKITGTALSFITNLKKLCNHPQLILDKCQK
KEEGFEGCLELFPREFSGKFEPAFSGKMKVLDYLLAITRATTNDKFVLVSNYTQTIDAFVELCQLRRYPYIRLDGTCTIK
QRAKLVEKFNDPESVEYVFLLSSKAGGCGLNLIGANRLIMFDPDWNPANDDQAMARVWRDGQKKNCFIYRLLATGSIEEK
MFQRQAHKKALSSCVVDEASDVARHFSKDQLRDLFDLKTDIASDTHNSLKCSRCVNGIEYREPQECADTNSDLSEWYHVQ
KDVRKVPDKVLKRIFECGTITFVFHQKSHDVKSEIIKEEDEIKENDLLNEEGEG
Estimated Isoelectric Point:
8.61782073974609
Estimated Molecular Weight:
87.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr41
Lys66
Gln28
Leu83
Gly43
Met17
Ser51
Tyr20
His17
Glu52
Arg48
Cys26
Phe30
Pro33
Val43
Asn32
Ala41
Ile47
Trp6
Asp50