Sequence:
download
OVP13097sequence.fasta
>Ovo-LIN-7 MEESSDGLHLDRDIQRILELIEHVQKTGELNSPKLTSLQNILQSDFFSSVREVFESVYDTISADSSREVRTSATAKATVA AFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRNGQLKRGDQLIAVNGVNVEWESHEKAVDVL KSARGTVRLVVRYTPRLLDEMERRFERQRRRANQNSPAPIFKR
view sequence (203 aa)
>Ovo-LIN-7
MEESSDGLHLDRDIQRILELIEHVQKTGELNSPKLTSLQNILQSDFFSSVREVFESVYDTISADSSREVRTSATAKATVA
AFAAAEGHAHPRIVELPKTDQGLGFNVMGGKEQNSPIYISRIIPGGVADRNGQLKRGDQLIAVNGVNVEWESHEKAVDVL
KSARGTVRLVVRYTPRLLDEMERRFERQRRRANQNSPAPIFKR
Estimated Isoelectric Point:
8.03986358642578
Estimated Molecular Weight:
22.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys9
Gln10
Leu16
Gly13
Met3
Ser17
Tyr3
His5
Glu17
Arg20
Phe7
Pro8
Val17
Asn9
Ala16
Ile12
Trp1
Asp11