Sequence:
download
OVP12910sequence.fasta
>Ovo-CEH-22 MFPLNAAAFAAAHAAATNSGSTFGTATAIAGLPESNSNSLGSSQCLVTVAGTPTTANFISNKCDLLKPDILDATGISNCH NYPTSSWTDHLPLLGGYHRASPAFDASYSPCTTSYSIYDQSVFNTHQSCFTSPAVPLGFEIINAPVGCSQVEKNLEPPLL PTSSHCNKSENEEDINNDSITSKEANEDITDVLNENETVNEDVEEERGKKKRRKRRVLFTKLQTYELERRFRTQRYLSAP EREQLAMQIRLTPTQVKIWFQNHRYKTKKTCQDKGLNSNLIQSNMPMPSVNFPQSKRIPVQMLVHDGKRCPMDFVTGTCP PPNTLPSPFTSNGNYFTPTSSILPSSSHYYISNGWAW
view sequence (357 aa)
>Ovo-CEH-22
MFPLNAAAFAAAHAAATNSGSTFGTATAIAGLPESNSNSLGSSQCLVTVAGTPTTANFISNKCDLLKPDILDATGISNCH
NYPTSSWTDHLPLLGGYHRASPAFDASYSPCTTSYSIYDQSVFNTHQSCFTSPAVPLGFEIINAPVGCSQVEKNLEPPLL
PTSSHCNKSENEEDINNDSITSKEANEDITDVLNENETVNEDVEEERGKKKRRKRRVLFTKLQTYELERRFRTQRYLSAP
EREQLAMQIRLTPTQVKIWFQNHRYKTKKTCQDKGLNSNLIQSNMPMPSVNFPQSKRIPVQMLVHDGKRCPMDFVTGTCP
PPNTLPSPFTSNGNYFTPTSSILPSSSHYYISNGWAW
Estimated Isoelectric Point:
6.74947357177734
Estimated Molecular Weight:
39.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr32
Lys17
Gln14
Leu26
Gly16
Met6
Ser38
Tyr11
His9
Glu19
Arg15
Cys10
Phe15
Pro28
Val15
Asn28
Ala24
Ile16
Trp4
Asp14