Sequence:
download
OVP12356sequence.fasta
>Ovo-CES-2 MDRSTSVHLRNALNAVHSPQLIQNNEKPPLPVDLNTALSLLTRPTVTLPASFPHFSPFSFPDPSTLFAFSQLRSNLPNYQ TATIISPLLSATIPTTSAISGPSLGPSPIKRPNREQQSASSPPSCSSSSVTSSCSPQQSPHRKQAAPVPDDKKDEAYYER RRKNNDAAKRSRDARRQKEEAVAARAAFLEQENIQLRSQVVLLKNETAKLQLMLFSKPKLLDPTMLSAGHSNSSEQQQKP ESADV
view sequence (245 aa)
>Ovo-CES-2
MDRSTSVHLRNALNAVHSPQLIQNNEKPPLPVDLNTALSLLTRPTVTLPASFPHFSPFSFPDPSTLFAFSQLRSNLPNYQ
TATIISPLLSATIPTTSAISGPSLGPSPIKRPNREQQSASSPPSCSSSSVTSSCSPQQSPHRKQAAPVPDDKKDEAYYER
RRKNNDAAKRSRDARRQKEEAVAARAAFLEQENIQLRSQVVLLKNETAKLQLMLFSKPKLLDPTMLSAGHSNSSEQQQKP
ESADV
Estimated Isoelectric Point:
9.69042205810547
Estimated Molecular Weight:
26.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys13
Gln17
Leu25
Gly3
Met3
Ser36
Tyr3
His5
Glu11
Arg16
Cys2
Phe8
Pro26
Val10
Asn13
Ala23
Ile7
Asp10