Sequence:
download
OVP11442sequence.fasta
>Ovo-CES-1 MSNWPPSATTYPTILNEWYFSPRFHPASTMKQEFRNQISISPPNMIFTNNTESGSKLLTSCLLSHLAVPEFSRPSLELPK NLVPNLNMHLQNELDRTLTDSESLSLPTTSSNEKGLSKQAKNCKVDAFSIESLLSKTNSSRTTMNMRLPENSFPKELSTS NIQICERGTTRYTLDALQSTDGRSKRKKELNTDKEISAIGLPGRLICNQCGKSYATTSNLSRHKQTHRPLDSPYAKQCPN CDRVYVSMPALSMHMLTHKAAHKCTQCSKTFSRPWLLQGHMRAHTGQKPYGCAHCGKAFADRSNLRAHMHTHSGIKKYEC PGCGKLFALKSYLNKHIELVCPIQRALRNQHVTSSQTSLMTTWESKSGINTT
view sequence (372 aa)
>Ovo-CES-1
MSNWPPSATTYPTILNEWYFSPRFHPASTMKQEFRNQISISPPNMIFTNNTESGSKLLTSCLLSHLAVPEFSRPSLELPK
NLVPNLNMHLQNELDRTLTDSESLSLPTTSSNEKGLSKQAKNCKVDAFSIESLLSKTNSSRTTMNMRLPENSFPKELSTS
NIQICERGTTRYTLDALQSTDGRSKRKKELNTDKEISAIGLPGRLICNQCGKSYATTSNLSRHKQTHRPLDSPYAKQCPN
CDRVYVSMPALSMHMLTHKAAHKCTQCSKTFSRPWLLQGHMRAHTGQKPYGCAHCGKAFADRSNLRAHMHTHSGIKKYEC
PGCGKLFALKSYLNKHIELVCPIQRALRNQHVTSSQTSLMTTWESKSGINTT
Estimated Isoelectric Point:
9.53084564208984
Estimated Molecular Weight:
41.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys27
Gln15
Leu38
Gly15
Met12
Ser45
Tyr9
His16
Glu17
Arg20
Cys14
Phe10
Pro23
Val7
Asn24
Ala19
Ile14
Trp4
Asp9