Sequence:
download
OVP09684sequence.fasta
>Ovo-HRP-2 MKKKGSRGRPRKQQQVATPVMSETDDGEQTVALAAEENANEEGIITTIAQEEEKAGEDNTMTEMKMETSADETLDEEPET QEEQLQEQEQEQEQEQEEGDDDEEEEEATTANGDEMKKEDSDILANAVGASGDGETEDAQALLAEIEEAEFVENEVYKGL RAQSIKPKVAVALIELYEATDMSPQELDDRAIEMLRSLPLEHALFIIKEVRESKLMGVQNKAQFLMSVMRNFRDKVRQLG ANVALSQKLVNGPSVEKIKEILDRTGYNLEVTIGQRKYGGPPPDWNGSPAGPQGSGHEIYIGKIPKEVYEDTLITLFEDM GKIWDLRLMMDPLTGRNRGYAFLTYCDKSAAYEAAKKFDGYEIMPGKNLKVNVSVANTRLFIGNIPKSKSKEEILAEFKE HTEGVTDCIIYSSPDAGESRKNRGFCFLDFCDHKTASDAKRKIHAGKLRPWNSDLVVDWAEQQEEPDEETMAKVKVLYVR NLKEAVTEEQLKEMFSAYGEVDRAKKIRDYAFIHFMEREPAIKAMEALNGTELEGIAIDISLAKPQSDKKKMMRGRGRGF GSLRGAFGDFSFGRGVRGGRGTANFGRGSFGSPTDFGYSGYDPYAGYEELYGYGTPPSAYGYGYDAYGYGPDPYGYGYGS PPIGGRGGRGGIPGGGFQPRGSAGRSRGTGGRGGRGATTPRGAKRPGDAAGGPASKREFGNDDFSADVNMNSF
view sequence (713 aa)
>Ovo-HRP-2
MKKKGSRGRPRKQQQVATPVMSETDDGEQTVALAAEENANEEGIITTIAQEEEKAGEDNTMTEMKMETSADETLDEEPET
QEEQLQEQEQEQEQEQEEGDDDEEEEEATTANGDEMKKEDSDILANAVGASGDGETEDAQALLAEIEEAEFVENEVYKGL
RAQSIKPKVAVALIELYEATDMSPQELDDRAIEMLRSLPLEHALFIIKEVRESKLMGVQNKAQFLMSVMRNFRDKVRQLG
ANVALSQKLVNGPSVEKIKEILDRTGYNLEVTIGQRKYGGPPPDWNGSPAGPQGSGHEIYIGKIPKEVYEDTLITLFEDM
GKIWDLRLMMDPLTGRNRGYAFLTYCDKSAAYEAAKKFDGYEIMPGKNLKVNVSVANTRLFIGNIPKSKSKEEILAEFKE
HTEGVTDCIIYSSPDAGESRKNRGFCFLDFCDHKTASDAKRKIHAGKLRPWNSDLVVDWAEQQEEPDEETMAKVKVLYVR
NLKEAVTEEQLKEMFSAYGEVDRAKKIRDYAFIHFMEREPAIKAMEALNGTELEGIAIDISLAKPQSDKKKMMRGRGRGF
GSLRGAFGDFSFGRGVRGGRGTANFGRGSFGSPTDFGYSGYDPYAGYEELYGYGTPPSAYGYGYDAYGYGPDPYGYGYGS
PPIGGRGGRGGIPGGGFQPRGSAGRSRGTGGRGGRGATTPRGAKRPGDAAGGPASKREFGNDDFSADVNMNSF
Estimated Isoelectric Point:
4.84406280517578
Estimated Molecular Weight:
78.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys49
Gln27
Leu41
Gly84
Met22
Ser38
Tyr28
His6
Glu80
Arg42
Cys4
Phe26
Pro34
Val30
Asn25
Ala61
Ile33
Trp4
Asp46