Sequence:
download
OVP09303sequence.fasta
>Ovo-DAF-21, isoform a MSDEMNGETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQALTEPAELETGKELYIKITPNKADKTLT IMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVASKHNDDDCYQWESSAGGSF IIRQVNDPELTRGTKITLYIKEDQTDYLEERRIKEIVKKHSQFIGYPIKLTVEKERDKEVSDDEAEDEKKDESKEKQEGE IEDVGEDEDEDKKEKDKKKKKKIKEKYHEDEELNKTKPIWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHFSVEGQLEF RALLFVPQRAPFDLFENKKTKNAIKLYVRRVFIMENCDELMPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLV KKCLELFDEIAEDKDNFKKFYEQFSKNIKLGIHEDSTNRKKLSEFLRFYTSASSEEMTSLKDYVSRMKENQKQIYFITGE SREAVASSAFVERVKRRGFEVVYMTDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFEEDKVKFENLCKVMKD ILEKKVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVVKALRERVEADKNDK TVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDITEDEEEEVVASVSGEKDECVPNLVGAEEDASRMEEVD
view sequence (718 aa)
>Ovo-DAF-21, isoform a
MSDEMNGETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYQALTEPAELETGKELYIKITPNKADKTLT
IMDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAFLVADKVVVASKHNDDDCYQWESSAGGSF
IIRQVNDPELTRGTKITLYIKEDQTDYLEERRIKEIVKKHSQFIGYPIKLTVEKERDKEVSDDEAEDEKKDESKEKQEGE
IEDVGEDEDEDKKEKDKKKKKKIKEKYHEDEELNKTKPIWTRNPDDISNEEYAEFYKSLSNDWEDHLAVKHFSVEGQLEF
RALLFVPQRAPFDLFENKKTKNAIKLYVRRVFIMENCDELMPEYLNFIKGVVDSEDLPLNISREMLQQSKILKVIRKNLV
KKCLELFDEIAEDKDNFKKFYEQFSKNIKLGIHEDSTNRKKLSEFLRFYTSASSEEMTSLKDYVSRMKENQKQIYFITGE
SREAVASSAFVERVKRRGFEVVYMTDPIDEYCVQQLKEYDGKKLVSVTKEGLELPESEEEKKKFEEDKVKFENLCKVMKD
ILEKKVEKVAVSNRLVSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVVKALRERVEADKNDK
TVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDITEDEEEEVVASVSGEKDECVPNLVGAEEDASRMEEVD
Estimated Isoelectric Point:
4.99242401123047
Estimated Molecular Weight:
82.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys82
Gln21
Leu58
Gly29
Met20
Ser51
Tyr23
His9
Glu91
Arg29
Cys8
Phe31
Pro16
Val48
Asn29
Ala41
Ile44
Trp4
Asp54